KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_3171Help
Entry
Dhaf_3171         CDS       T00822                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dhaf_3171
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dhaf_3171
   00052 Galactose metabolism
    Dhaf_3171
   00500 Starch and sucrose metabolism
    Dhaf_3171
   00520 Amino sugar and nucleotide sugar metabolism
    Dhaf_3171
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dhaf_3171
   00524 Butirosin and neomycin biosynthesis
    Dhaf_3171
Enzymes [BR:dhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dhaf_3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3397254..3398339
Genome map
AA seq 361 aa AA seqDB search
MPYAGIEKGQLYLAGDIGGTKTLLGLYSLEGTELVLVRERNFPSKDWQDLTALIQGFLDE
IALTPEDITGGCLSLAGPITQDKCFLTNLNRVIDCPDLRSSLPLRRPLLLVNDLEAMGQG
LMDLRGEDLICLNPSAESPSSSLASSPALSLARPSLNRALIAPGTGLGQAMILADGRVCA
TEGAHGDYAPRTEQEVRLWRFLAQRYGHVSYERVLSGPGLADLYRFLYWEALSPSLPGPA
SDSIPAPDSSLTPAEITKKALDGICTLCTETLELFVKILGAEAGNLALRTLAYGGIYLGG
GIPPKILPKLQEDGFMEAFLAKGRLRELLSQIPIYVILNERTPLLGAARLAVAAGYPFTC
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgccttatgcaggcattgaaaaaggccaactatacttggctggagacattggcggaacc
aaaactctcctaggactttattccctggaaggcactgagcttgtcttagtcagggaaagg
aatttccccagtaaagactggcaggacttaacagcgcttatacaaggatttttagatgaa
atagccctaacgcctgaagacataaccggaggctgcctcagcctggccgggcccatcact
caagacaaatgttttctcaccaatttgaatcgggtgattgattgccctgacttgcggtcc
tccctgccattgcgcaggcccctgcttttggtcaacgaccttgaggctatggggcagggc
cttatggatttaagaggggaagatttaatttgtctcaacccttccgcagagagtccttcc
tcttcccttgcctcgtctcctgccctttccctcgccaggccctcacttaaccgggcactg
atcgcccccggtacaggcttgggtcaggccatgatcctggctgacgggcgggtttgcgcc
acagaaggcgcccatggggactatgccccccgcaccgagcaggaagtacggttgtggcgc
tttctggcccaacgatacggtcatgtcagctatgagagagtcctctccggtcccgggctg
gcagatctctatcgttttctgtactgggaggctctttccccctctctccctggcccggcc
tctgactctatccctgctcctgattctagccttactcctgccgagatcacaaaaaaagcc
ctcgacggaatctgtacactctgtacagaaacattggagctctttgtgaaaattctgggg
gcggaagcaggcaatctcgctttaaggactttggcctatggaggaatctatctgggcggg
ggcatcccccctaaaatcctgcccaagcttcaggaagatggcttcatggaggcctttctc
gctaaaggccgtttgagagagcttttatcccagatccctatctatgtgatccttaatgaa
aggactcctttgctgggagccgcccgtttggcggtggcagccgggtatccttttacatgc
tcttaa

DBGET integrated database retrieval system