KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_3195Help
Entry
Dhaf_3195         CDS       T00822                                 

Definition
bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dhd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3415818..3419399)
Genome map
AA seq 1193 aa AA seqDB search
MVLAYHNSHDPFFRSPFGAVPCGGLLRLRLLMQPEDSSGAGSPVQECFLRLWVQDREERL
PMLRVEEPILWEINREGTVTGEEAITGEGVLTGEGVVYEVEYPLPHEPGIIWYYFIFRAG
GETCFYGNNQEELGGVGELRSSEPPGYQITVYRPMALPGWYTQGIMYQIYVDRFFNGDEQ
GKVLNPRPRSLIHGDWSDTPFYIKNEKGEVLRWDFFGGNLAGVIKKLPYLKELGVSILYL
NPIFDSSSNHKYDTGDYLTLDPMYGDEEIFAQLIKEAQSLGIAIILDGVFSHTGDDSIYF
NRYGRYPGLGAYQSPDSPYYSWYQCHGEGQEKEYSCWWGVSTLPEVWEMEPSYREFIIHS
PQGVLQSWMKRGIKGWRLDVADELPDEFIQEFRQMMKTMDPEGVLIGEVWEDPTHKFSYG
KLRQYFWGEELDATMNYPLRNIFLQYFLGQIDAGQAHKRIMNLYENYPRENFFGQMNLIG
SHDRARILTLLGEAPPPEQLSAVEQEQYRLPAPARDLAVQRLKLLTLLQMSFPGVPCLYY
GDEAGCEGYPDPYNRGTYPWGREDQEILQWFKRVLRYRREYEVLRQGEFSSWFEGKEIYV
LQRKGEKEEIIVLVNRSAEESTEMTLKLEQNVGQVIDIFAGEVLHSLSLILPPLSAKALF
YQKYERGHYFKQEIMTRACGILMHISSLPSPWGIGDLGEEAYAFVDFLAEGGQSLWQVLP
LNPLGLGDSPYQSESALAGNFLLISLDLLIEAGLLTEGEARREWADYGQEVKKTEGSEGS
EGSEGSEGSEGLGSEGFAWVERYKEKLLRKAYERFKEKLPRYPLDLSSPEGGSQPGTKGY
LDPQGYDRFIEENQDWLQDYALYKCLKLKFPGKAWHQWEESYRLRKPEALEAVTEDYAEE
INYIFFVQYTFADQWQRLKDYAQEKGVKIIGDLPIYVAYDSCDTWANRECFALDENNAPA
GTAGVPPDYFNPEGQNWGNPLYDWDALRAADYAWWKLRFRQGLERFDALRLDHFRGFEGY
WEVPPQAGSAKEGRWLKGPGKEFFESLVRELGPLPVIAEDLGCITPEVNTLRAILGFPGM
RVTQFSPLQQEGNYVDYSGTHDNDTLLGWYRSQGYSDKDSLAQVERTIEELYQGNGIWVI
FPLQDILKLDSRARMNTPGTIKGNWQWRVERGTLTQEVCARLRGLAEKYGRLS
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
gtggtattggcttatcataattctcacgatcccttcttccgcagcccctttggggctgtt
ccatgcggcggcctgctgcgcttaagactgcttatgcagccggaggattcttctggtgcg
ggcagtccggttcaggaatgctttttgcgcttatgggtgcaggaccgggaggagcggctg
cccatgctcagggtggaagagccgatcctgtgggagataaatagggaaggaactgttaca
ggggaagaggctattacaggggaaggggtccttacgggagaaggagtcgtttatgaggtg
gaatatcctcttccccatgaaccgggaatcatctggtattactttattttcagggcaggg
ggagaaacctgtttctatggcaataatcaggaagaactgggaggcgtgggtgagcttcga
tcctccgagcctcccggttatcaaatcaccgtttaccggcccatggccttgccaggctgg
tacacccagggcatcatgtatcagatctatgtggatcgcttctttaacggggatgaacag
ggaaaagtcctcaatccccgcccccgctccctgatccatggggactggtctgataccccc
ttctatattaaaaatgaaaagggcgaagtcctacgctgggattttttcggcggcaacctt
gccggtgtgatcaaaaagcttccttatcttaaggaattaggagtgagtatcctttatttg
aaccccatcttcgattcctccagcaaccataagtatgacacgggggattatctcactctt
gatcccatgtatggggacgaggagatctttgcccaattgatcaaggaagcccaaagctta
ggaatcgcgattattctggatggggtgttcagtcataccggtgatgacagtatttatttt
aaccgttatgggagatatcctggtctgggcgcctatcaatccccggattccccctattac
tcctggtatcaatgtcatggggaaggacaggaaaaagaatattcctgctggtggggagtg
tccactctccctgaagtttgggagatggagccctcttatcgcgagtttatcattcactct
cctcaaggagttctccaatcctggatgaaacggggtattaaaggctggcgtctggacgtg
gctgacgagcttcccgatgaatttatccaggagttccgccaaatgatgaaaacaatggac
cctgagggagtcctgatcggtgaagtctgggaggaccccacccataaattcagctatggc
aagctcaggcagtatttctggggggaagaactggatgccaccatgaattatcctttgcgg
aatatctttctccagtacttccttgggcagatcgatgccggtcaggcccataaacgcatc
atgaatctctatgaaaactacccccgggaaaactttttcgggcagatgaacttgatcggc
agccatgaccgggcccggattctcaccctcctcggtgaagcgccgccgccggagcagctc
tccgccgtggaacaggagcagtatcgcttgcctgcccctgcccgggatctggctgtccag
cggttgaaactgctgactttgctgcagatgagctttcccggtgttccctgtctgtactac
ggtgatgaagcgggctgtgaaggatatcccgatccctataaccgggggacctacccttgg
ggaagggaagatcaggagatcctccaatggtttaaacgggtgcttcgttatcgccgggaa
tatgaggtgctgcggcaaggcgagttctcttcctggttcgagggaaaagagatctatgtc
ttgcaaaggaagggtgaaaaagaggagattattgtcctggttaatcgcagtgctgaggag
tccacggaaatgacattgaagctggagcagaacgtggggcaggtgatcgatatctttgcg
ggggaagtgctgcacagtctttcgcttatcctaccccccttatccgcaaaggcccttttc
tatcagaaatatgagcgtggtcactattttaaacaggagatcatgacccgtgcctgcggc
atccttatgcatatctcctctttgccgtctccctggggcattggcgatctgggggaagag
gcctatgcttttgtggatttcctggctgaaggagggcaaagcctctggcaggtgctgcct
ttgaaccctctagggctgggagattccccttaccaaagtgagtccgccttagccggtaat
tttttgctgatcagtcttgatttgcttattgaggccgggctgctgaccgaaggggaggcc
cgcagggaatgggccgactatggtcaagaggttaaaaagactgagggaagcgaaggaagc
gaaggaagcgaaggaagcgaaggaagcgaaggcctcgggagcgagggctttgcctgggtg
gaacgctataaggagaagctgctgcgcaaggcttatgaacgtttcaaggagaaattgccc
aggtaccctttggatttaagcagtccggagggaggcagccagcctggaactaaggggtac
ttggaccctcagggttatgaccggtttatagaagagaatcaggactggctgcaagactac
gctctctataagtgtttaaagcttaagttccccggcaaggcgtggcaccaatgggaagaa
agctatcgcttgcggaagcctgaggccctggaggctgtgactgaagattatgccgaggag
ataaactatattttctttgttcaatatactttcgctgatcagtggcaaaggctgaaggac
tatgctcaggaaaaaggggtaaaaataatcggcgatctgcccatttatgtggcctatgac
agttgcgacacctgggctaaccgggagtgctttgctctggatgaaaataatgctcccgca
ggaaccgctggggtgccccccgactatttcaaccctgaagggcagaactggggaaatccc
ttatacgattgggatgctctccgggccgccgattatgcctggtggaagctgcgtttccgg
caagggctggagcgctttgatgccttaagactggatcatttccgtggctttgagggctat
tgggaagttccccctcaggccgggagcgccaaggaaggccgctggctgaaagggccgggg
aaagaatttttcgaaagcctggtccgtgaattggggcctctgcccgtcatcgctgaggat
ttagggtgcattacccctgaagtcaataccctgagagctattttaggatttccggggatg
agggtgacgcagttttcacccttgcagcaagaagggaattatgttgattattccggaacc
catgataacgataccctgttgggctggtatcgctcccaaggctatagcgataaggattcc
ctggcgcaagtggaaaggactatcgaggagctttatcaggggaatggtatctgggtcatt
ttcccccttcaggacattcttaaactggattcccgggcgaggatgaatactcccggcaca
attaaagggaattggcagtggcgtgtagaaagaggaaccttaactcaggaggtttgtgcg
cgattaaggggtttggcggaaaagtatgggcggttatcctga

DBGET integrated database retrieval system