KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_3200Help
Entry
Dhaf_3200         CDS       T00822                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dhaf_3200
Enzymes [BR:dhd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dhaf_3200
Exosome [BR:dhd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dhaf_3200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3425719..3427665)
Genome map
AA seq 648 aa AA seqDB search
MAWVGEDNALQVQDIKMQSKIQKDSPLLTQEEMYLFNCGEFYYSYRKLGAHFLEHKGRWG
TYFAVWAPQARQVSVVGDFNGWCGMNHSLQKWEEQGIWTLFIPGLPTGEIYKYEILNSSG
ESVLKADPYAFFSEVRPHTASVIYSLEDYAWGDQAWLAQRKTRNPKVLPLSSYEIHLGSW
RRTEDGRFLNYAQLVTVLIPYVKSLGYTHIEILPLMEHPYDGSWGYQITGFYACTSRYGT
PHDLMYLIDQCHQAGIGVILDWVPGHFCMDAHGLGKFDGSPLYEREVHEQWGTYKFDYSR
SEVRSFLISNAVFWLDVFHVDGLRVDGVSSMLYLDYGKEKGAWQPNRYGGRENLEAVGFI
KQLNATLHGLYPDALLIAEEATDWQGVTGPLDQEGLGFTFKWNMGWMNDTLRYIGLDFNE
RRSFHQLLTFPMMYAYAESYILPLSHDEVVHGKKSLLDKMPGDYGQKFAGLRGLTTYFMT
SPGKKLLFMGGEIPQFIEWREDRELDWFLMDYELHRKYHGFVQQLNGLYLREKALWEIDG
DWTGFEWIDVHNHEQGVIVFCRKGKSFQDRLVVLINFQPYNYERYRIGVEMAKGYREILN
TDSTDFGGWGMTNPGLLKVEGVPWHGREFSLEIRVPALGAMILKPELA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggcttgggtaggagaggataacgcattgcaggttcaagacatcaagatgcagtcaaaa
atacagaaggacagccctttgctcacccaagaagagatgtatctctttaattgtggtgag
ttttattatagttaccgcaaactcggtgctcatttcctagagcataaggggcggtgggga
acgtattttgccgtatgggctcctcaggccaggcaagtctctgtagtaggggattttaac
ggctggtgcggaatgaaccattctctgcaaaaatgggaggaacagggaatttggacactc
tttattcccggcctgcccacaggggagatctacaaatatgaaatcctcaactcttcagga
gagtcggtgttgaaagcggacccctacgcctttttttccgaagtgcggccccatacagct
tcggtgatctattccctggaggattatgcatggggggatcaggcttggctggctcagcgc
aaaaccaggaatcccaaagtgctgcccttgtccagctacgaaatccatttaggctcatgg
agaagaacagaagacggacggttccttaattatgctcaactggtaaccgtgttgatcccc
tatgtaaaatcgctgggctatactcatatagagatcctgccgctgatggagcatccttat
gacggctcctggggttatcagatcacgggattctatgcctgcaccagccggtatggcacc
ccccatgatctgatgtacctgatcgaccaatgccatcaggcgggaatcggtgtgatcctg
gattgggtcccgggccatttttgcatggatgctcacggtctgggcaaatttgatggaagt
cctctctatgagagagaagttcatgagcaatggggtacttataaattcgattattcccgt
tcggaagtccggagcttcctgatctccaatgcagtcttttggctggacgtctttcatgtg
gatggcttgcgggtggacggagtgagcagcatgctctatttggattacgggaaagaaaaa
ggagcctggcagcccaacagatatggcggccgggaaaatctggaggccgtcggctttata
aaacagctcaatgcaacccttcatggcctttatcccgacgccttgctcatagccgaagaa
gctacggattggcagggggtgaccgggcctcttgatcaggaaggactggggttcacgttt
aaatggaatatgggctggatgaatgataccctccgttatattggcctggacttcaatgaa
cgcagatcctttcatcagctcttaacctttcccatgatgtatgcctatgctgagagctac
attctcccgttgtcccatgatgaggtggtccatggcaagaagtccttactggataaaatg
ccgggagattacggacagaagtttgcaggtttaaggggactaaccacctatttcatgacc
agtcccggcaaaaagctgctctttatggggggagagatccctcagttcatcgagtggcgg
gaagatcgggagctggactggtttcttatggattatgagctgcatagaaaataccatggc
tttgttcaacagctcaatgggctgtatttgcgggaaaaggccttatgggaaatcgatggg
gactggaccggatttgaatggatcgatgtccataaccatgaacagggagtgatagtcttt
tgccgcaagggaaagtcctttcaggacaggctggtggttctgatcaattttcagccttat
aactatgaaaggtatcgaatcggagtggaaatggccaagggttaccgggaaatactgaac
accgactcgacagacttcggtggatggggtatgaccaatcccgggcttttaaaagtagag
ggagtaccgtggcatggccgggaattttccctggaaattcgggttcctgctctgggtgcc
atgatattaaagcccgaacttgcataa

DBGET integrated database retrieval system