KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_3353Help
Entry
Dhaf_3353         CDS       T00822                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00860  Porphyrin and chlorophyll metabolism
dhd01100  Metabolic pathways
dhd01110  Biosynthesis of secondary metabolites
dhd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dhaf_3353
Enzymes [BR:dhd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Dhaf_3353
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dhaf_3353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ACL21371
JGI: Dhaf3353
UniProt: B8G2M1
Position
complement(3587164..3588678)
Genome map
AA seq 504 aa AA seqDB search
MDKGYVYLVGAGPGDPKLITVKGAECIAKADVLIYDRLASRRLLTLARPDCELIYVGKSP
DRHTLRQEEINALLVQKGLEGKIVTRLKGGDPFVFGRGGEEAEDLLQAGIPFDIVPGVTS
AISVPAYAGIPVTHRDLTSSFAVITGHEDPTKNSSALAWEHLATAHGTLIFLMGMENLSL
IATKLMENGRSPSTPVGIIQWGTRPEQRVLVGELQNIAQLVKEEGFTNPSIIIVGEVVQL
REKLQWFEKRPLFGQRIIVTRARHQASALSQGIEDLGGEPWEFPAIEIVPPRDPQPLIQA
IKNLKRFEWLIFTSVNGVEEFFKVLMEQGRDVRDLAGMDVVAIGPATRDALEKRCLKVSF
VPEEYRAEKIIEGLASRVLPGQSVLLARAEEARDILPESLKALGADVWDVPTYRTVLGNA
NKEELMKLLEEKAVAAVTFTSSSTVRNFLQLIDGRQSLLDGVKLYSIGPITSKTAQEFGL
SIYREAKQYTIKGLLETLARGNEE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
ttggacaaaggatatgtatatttggtcggtgccgggccaggggatccgaaactcattaca
gttaagggcgcggagtgcattgccaaggccgatgtgctgatctacgatcgcctggcttca
cgccgtctcctgaccttagcccgtcccgattgtgaacttatttatgtagggaaatccccg
gaccggcacaccctgcgccaggaagagatcaacgctcttctggttcagaaaggcctggag
ggtaaaatagtgacgcgtttaaaggggggggacccttttgtttttggacgcggtggggaa
gaagcagaggatctgcttcaggcagggattccctttgatattgttcccggtgttacctca
gcgatttccgtacctgcttatgcaggtatcccggtgactcatcgtgatttaacctcttct
tttgctgtcataaccggtcatgaagaccccactaaaaacagctcggctttggcttgggaa
catttagccacggctcacgggactttaatctttttgatgggcatggaaaatctgtccttg
atcgccactaaacttatggaaaatggccgttcaccgtcaacccctgtgggaattatccaa
tgggggacccggccggaacaaagggtgctggtcggtgaacttcaaaatattgctcaattg
gtaaaggaagaaggctttaccaacccctcgatcatcatcgtgggagaggttgttcaacta
agggagaaactgcaatggttcgaaaagagacctctcttcggtcagcggatcattgtgacc
cgggccaggcatcaagccagcgccttgtctcaaggcattgaagatctgggcggagaaccc
tgggagtttccggcgattgaaatcgtaccccccagggaccctcagcccctgattcaggcc
atcaagaacctgaagcggtttgaatggctgatctttaccagtgtcaacggcgtggaggaa
ttctttaaagttctcatggagcagggcagggacgttcgtgatctggccggtatggatgtg
gtcgctatcggtccggccaccagagatgctttggagaagcgctgcctgaaggtctctttt
gttcctgaagaatatcgtgctgaaaaaatcatcgaagggctggccagccgggttctgccc
ggtcaaagtgtgctcctggcccgggccgaagaagcccgggatattctgcccgaatccctg
aaagctttaggggcggatgtctgggatgttcccacctatcgtacagttttggggaatgcc
aacaaggaggaattgatgaagttgctggaggagaaagctgtagcggctgttacctttacc
agttcctccacagtacgcaatttcctgcaattaattgatggcaggcaaagccttttggat
ggagttaaactctattctatcggtcccattaccagcaaaacagctcaggaatttgggttg
agcatttaccgggaagcaaagcagtatactattaaggggctgcttgagactctggcaagg
gggaacgaggaatga

DBGET integrated database retrieval system