KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_3413Help
Entry
Dhaf_3413         CDS       T00822                                 

Definition
family 2 glycosyl transferase
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3649526..3650317)
Genome map
AA seq 263 aa AA seqDB search
MLFVVLPAYNEEAGLQPLLDDISKACQGIPLQIIVVNDASTDHTLEIARDYALSNPAVQV
LSHTRNKGLGGSLMTGFKHVFAQRRMLGEQSGEWIGHDDVILTMDADNTHPAERIPLMAE
LIQQGADLVVASRYAPGGKQYGLNPLRQVLSWGAGQVMTVFFPVEGLRDYSCGYRAYRAS
VLESAYIIYGEELIESRSFAGMVELLVKVANYCGEIREIPFDLHYEKKQGKSKMKILATI
MGYFALILRLKKEKWGWVEWVGE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgttgtgttgcccgcttacaatgaggaggcaggtctgcaaccgctccttgat
gatataagcaaggcctgtcaggggattcccctgcaaattattgtcgtcaatgacgccagc
acggatcataccctggagattgcccgggattatgccctgagcaacccggcggttcaggtt
ctgtcccatacccggaacaaagggctggggggcagcttgatgacagggtttaagcatgtc
tttgcccagaggagaatgttaggggaacagtccggtgaatggatagggcatgatgatgtt
atcctgacgatggatgccgataatactcatccggcggaacgcattccgcttatggcggag
ctgattcagcaaggggcggatctggtcgtggcctcgcgctatgctcccggcggcaagcaa
tacggtctgaacccactgcggcaggttctctcctggggagcagggcaagtcatgaccgtg
ttttttcctgtggagggactgagggactattcctgcgggtaccgggcttatcgggcttca
gtcttagagagcgcttacataatctatggggaagagctcattgaaagtcgcagctttgcc
ggaatggtggagcttttagtgaaggtagccaactattgtggggagattcgggagattcct
ttcgacttacattatgagaagaaacaaggaaaaagcaaaatgaaaatcttagccacgatt
atgggctattttgctttaatcctgcgcttaaagaaggaaaaatggggttgggtggaatgg
gtaggcgagtaa

DBGET integrated database retrieval system