KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_3894Help
Entry
Dhaf_3894         CDS       T00822                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00230  Purine metabolism
dhd01100  Metabolic pathways
Module
dhd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dhaf_3894
Enzymes [BR:dhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dhaf_3894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 AAA_16 RNA_helicase ADK AAA_17 TsaE Thymidylate_kin ABC_tran RsgA_GTPase MMR_HSR1 AAA_28 Cytidylate_kin AAA_5 APS_kinase NTPase_1 Rad17 Zeta_toxin MobB AAA_29 cobW AAA PduV-EutP T2SSE ATP_bind_1
Motif
Other DBs
NCBI-ProteinID: ACL21910
JGI: Dhaf3894
UniProt: B8FSC2
Position
complement(4128190..4128792)
Genome map
AA seq 200 aa AA seqDB search
MEQNHGLLIVLSGPSGAGKGTLCQELLRQLPQVKYSVSATTRQPRPGEVDGLHYYFRSRE
EFQTMIEQDQLLEWAEFCGNYYGTPQFAVEQAIQAGNDVILEIEIQGALQVKQRFPQGVF
IFVVPPSMDELSQRIHKRGTESEEVIQKRLQTAARELEYVSEYDYVVVNDEIPLAVDKLK
SILLAEKCRVKRKPYVFQGV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtggaacaaaatcatggcttattgattgttctatccggtccttccggggcgggaaaagga
accctttgccaggaactgctgagacagctgcctcaggtaaagtattccgtgtcggccacg
acacgccagccccgtcctggtgaagtggatggattgcattattatttccgtagccgggaa
gaatttcaaaccatgatcgaacaggatcaacttttggaatgggcagagttttgcggtaac
tattacggaactccccagttcgctgtggagcaggccattcaagccgggaatgatgtcatt
ctggagattgaaattcagggagctttacaagtcaagcagcgtttcccccagggagtgttt
atttttgtcgtgccgccctccatggatgaactttcccagcgcatccataaacggggcacc
gaatccgaggaagtgattcaaaaacggctgcagactgccgctcgggaactggaatatgtg
agcgagtatgattatgtggtcgtcaatgatgaaattcctctggcagtagacaaattaaag
agcattctgctggctgagaaatgccgtgtgaaaagaaaaccttatgtatttcagggggtg
taa

DBGET integrated database retrieval system