KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_4370Help
Entry
Dhaf_4370         CDS       T00822                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dhaf_4370
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dhaf_4370
Enzymes [BR:dhd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dhaf_4370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4638493..4639305
Genome map
AA seq 270 aa AA seqDB search
MDILERILIAKRKRLQARERQLPLAELKRQLEGKIISRPGKPKLTPHSFHVIAEIKRASP
SKGMIPWRHSLEETLQAYESGGASFISILTEEDFFLGGPEDWQRGRMLTSLPLLRKDFIL
SEYQVIESAVMGADMILLIAGILDTAALPNLLHLTHELGMKALVECRDEKDVSRALQARA
KIIGINNRDLSTFRISLGRTQFLSSLIPADCLLVSESGIHTPEDAAWVSSHGAQAVLVGE
SCLLSPDPALHIRSLREAGLSAKVVKPCPG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatattctcgaaagaattctcatcgcgaaacgaaaaaggctccaagctcgagaaaga
cagcttccccttgccgagcttaagcggcaattagagggcaaaatcattagccgcccgggg
aaaccaaaacttaccccccattcctttcatgtcattgctgagatcaagcgtgcttcccca
agcaaaggaatgatcccttggcgccactccctggaagaaacccttcaggcttatgaatcc
ggcggagcctcctttatctccatactcaccgaggaggactttttcctgggggggcctgaa
gactggcaaagaggccgcatgttaacctctcttccgctcctgcgcaaagattttatcctt
tccgaatatcaggtcatcgagagcgccgttatgggagcggatatgattctgctcattgcc
gggattctggacactgccgcgctccccaatctgcttcatttgactcatgaactgggaatg
aaagccctggtcgaatgccgtgatgaaaaagatgtttcccgggctctccaagctagagcg
aagatcatcggtatcaataaccgggacctgagtaccttccggataagccttggccgcacc
caattcctcagttccctgatcccggctgattgccttctggtcagcgaaagcgggatccat
actcccgaagatgcggcatgggtctccagccatggcgctcaggcggtccttgtcggcgaa
tcctgccttctgtcccctgatcccgctttgcatatccgctccctgcgcgaggcaggcctg
agtgctaaggtggtgaaaccatgccccggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system