KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_4514Help
Entry
Dhaf_4514         CDS       T00822                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00040  Pentose and glucuronate interconversions
dhd00052  Galactose metabolism
dhd00500  Starch and sucrose metabolism
dhd00520  Amino sugar and nucleotide sugar metabolism
dhd01100  Metabolic pathways
dhd01130  Biosynthesis of antibiotics
Module
dhd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dhaf_4514
   00052 Galactose metabolism
    Dhaf_4514
   00500 Starch and sucrose metabolism
    Dhaf_4514
   00520 Amino sugar and nucleotide sugar metabolism
    Dhaf_4514
Enzymes [BR:dhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dhaf_4514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACL22515
JGI: Dhaf4514
UniProt: B8FWL7
Position
complement(4796788..4797672)
Genome map
AA seq 294 aa AA seqDB search
MSTRRIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVHSGIEDIIIVTG
RNKRAIEDHFDRSIELETFLQKSEKEELLDMVQDIARMVDIYYVRQKEALGLGHAIYCAR
KFIGNEPFAVLLGDDIIHSEVPCLRQMMHVYERHGASIVGVQQVPLEDTSKYGIVDAVPL
DDSLYRALDLVEKPQPEDAPEARLAIMGRYILNPEIFGILESIPPGKGGEIQLTDGLKEL
ARFQEILAYEFDGQRYDVGDKLGFVQATIEYALRREDLAEPLMRYLKQRIESDE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgagcacgcgacggattagaaaggccattattccggcagcaggcttgggaacccggttt
ttacccgctaccaaagcccagcccaaagagatgcttcccatcgtggataaaccgaccatt
caatacattgtcgaggaagccgttcactccggaatcgaagatattatcattgtcaccggc
cgcaataagcgggccattgaggaccattttgatcgctccatagaattggagacctttctt
cagaaaagtgagaaggaagaactcctggacatggttcaggatatagcccggatggtggat
atttattatgtgcgccagaaagaagctttggggctgggacacgctatttattgtgccaga
aaattcatcggcaacgagccctttgccgtcctgttaggcgatgatattatccattccgaa
gtaccctgcctcaggcagatgatgcatgtctacgaacggcatggggccagtatcgttggc
gtccaacaggtacccctggaagatacctcaaagtatggaatcgttgacgcggtacctctt
gatgattccttataccgggctctggacctggtggaaaagccacagcctgaggatgctcct
gaggcccgtttggctatcatgggccgctatattcttaatcccgagatttttggcatcttg
gagagtatcccccccggcaaaggaggagagatccagcttacggacggtttaaaagaactg
gccaggttccaggagattcttgcttatgagttcgacggacagcgttatgatgtgggggac
aagctgggttttgttcaagccaccattgaatacgccctgcgccgggaagatctcgccgaa
cctctcatgcgctacctcaaacaacggattgaatcggatgaatag

DBGET integrated database retrieval system