KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_4532Help
Entry
Dhaf_4532         CDS       T00822                                 

Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K07516  
3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Fatty acid degradation
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dhaf_4532
   01212 Fatty acid metabolism
    Dhaf_4532
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dhaf_4532
  Lipid metabolism
   00071 Fatty acid degradation
    Dhaf_4532
Enzymes [BR:dhd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Dhaf_4532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4819776..4822163)
Genome map
AA seq 795 aa AA seqDB search
MAIYKVAVLGSGVMGSTIAAHLANAGIPSILLDIVPPSLLPEEEAAGLTLASPQVRNRFA
ASNKAKLIKMNPAPLFVPEFADRIEVGNFEDDLPRLQEVDWVIEVVVERLDIKIDLFKKV
AQHVRPGTIVTSNTSGISLKSMTEGLPEEFTKSFFGTHFFNPPRYMKLFELIPGPNTDPT
VIQEMEEFAERVLGKGVVYAKDTPNFIANRIGVFGLAATIREMQRSGLTIDEVDALTGPV
MGRPKSASFRTVDMVGLDTFVHVANNVGDNVPEEKEFFVMPDFIHTMIKNGWLGDKSKQG
FYKKVKTAEGKEVLVLDPHTMEYVPKKKVKFACLDKAKNAGGLKDKMKTLVNGKDPGAEF
AWNVLKEVLLYAARLAPQIADDLTALDAGMKLGFNWEMGPFETWDALGVKATAERIAAEG
GTLPEIVAKLLAEGKDSFYEKTEGGDTLYYAGGEYKEKAASPYSFSLKKAHKQGKKIFGN
SGASLVDMGDGVACLEFHSPNNSIGGDIMNMIHKSLAEVEKNYLGMVIGSQGKNFAVGAN
LMLIMMEAEEGNWDDLDLMVREFQRGTMALKYAKKPVVAAPYGMTLGGGTEVCLHSHAIQ
PAAETYMGLVELGVGLIPGGGGTKEMALRAMEGILPGVVVAPDYFFAKRFEVVAMAQVST
SAEMARKLGFLRASDRCSMNADHVLLDAKARVLDLARDFRPIIPQKVKAAGPGVCAFLEM
ALYGMKEGRYISEYDAHLGKKLAYAMTGGDVLAGTLVDEQYLLDLEREVFLSLAGEPKTL
DRIRHMLTKNKPLRN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggccatctataaagtggcggttttaggctcaggggttatgggaagcaccatcgcggcc
catctcgccaatgccgggattcccagtatactgctggacatagtaccccctagtttgttg
ccggaggaagaagcggccgggctgaccttggcatccccccaagtcagaaatcgttttgcc
gcatccaacaaagccaaactcatcaagatgaaccctgctccgctgtttgtgccggaattt
gcggatcgcatcgaagtcggcaattttgaggatgatctgccccgtttgcaagaagtggac
tgggttattgaagtggtcgtagagcgtttggacatcaaaatcgacctctttaagaaggtg
gcccagcatgtccgcccggggaccattgtaacatccaacacttccggtatttctttaaaa
tccatgacagaagggcttcctgaagaatttaccaagagctttttcggcacccacttcttt
aatcctccccgttatatgaagctttttgaactgattcccggacccaacacggatccgacc
gttattcaggagatggaagagtttgccgagcgggtgctgggcaaaggggtcgtctatgct
aaggatacgcccaacttcatcgccaaccgcatcggcgtctttggtttggcggcaaccatc
agagagatgcagcgttccggcttaaccatcgatgaagtggatgctttaaccggaccggtg
atgggacgtcctaagtcagcctccttccggaccgtggatatggtgggtctggacaccttt
gtccatgtcgccaataacgtgggagataatgtccctgaagaaaaagagttcttcgtcatg
ccggactttattcataccatgatcaaaaacggctggctgggagataagagcaagcagggg
ttctataaaaaagtcaagacagcagaaggcaaagaagtactggttcttgatccccatacc
atggagtatgttcccaagaagaaagtcaaatttgcctgcctggataaagccaagaatgcg
ggcggtcttaaagataagatgaaaaccttggtcaacggcaaagatcccggggctgaattc
gcctggaatgtcttgaaggaagttctcctttatgcggcccgcctggctccccaaatcgcc
gatgatcttacagctcttgatgccggtatgaagctgggcttcaactgggaaatgggacca
tttgagacctgggatgccttaggcgttaaagccaccgcggagcgcatcgcagctgagggc
gggaccttgcctgagatcgtggcaaaactgctggctgaaggcaaagacagtttctatgag
aagaccgaaggcggggacactctgtactatgccggaggcgaatataaggaaaaggccgcc
agcccctattccttctcccttaaaaaggcccataaacaaggcaaaaaaatcttcggcaat
tccggtgccagcttagttgatatgggtgacggtgtagcctgcctggaattccattcaccg
aacaactccatcggcggggatatcatgaacatgattcacaagtccttggcagaggtggaa
aagaactatttagggatggtgatcggcagtcagggtaagaatttcgccgttggtgccaac
ctgatgctgattatgatggaagcggaagaaggcaattgggatgacctggatctcatggtc
cgcgaattccaaaggggaaccatggccctgaaatacgccaagaagcctgtggtagccgct
ccctatggcatgactttaggcggtggaactgaggtttgcctccattcccatgccatccag
cctgcggctgagacctatatgggcctggtggagctgggcgtgggcctcatccccggcggc
ggcggcaccaaggaaatggccctgcgcgctatggaaggaattcttcccggcgtggtcgtt
gctccggactatttcttcgccaaacgcttcgaagtagtggccatggcccaggtttccacc
agtgcggaaatggccagaaagcttggcttcttaagggcaagtgatcgctgcagtatgaat
gccgaccatgttctcctcgatgccaaggcccgtgtccttgatctggcaagagacttccgc
cccatcattcctcagaaggtcaaagcagcaggaccgggagtctgtgccttcctggaaatg
gccctgtatggcatgaaagaggggcgttatatctccgaatacgatgctcacttagggaaa
aaactggcttatgccatgaccggcggcgatgttctggccggaactttggtggatgagcaa
tatctcctggatctggaaagagaagtgttcttaagccttgccggagaacccaagactctg
gatcgcatccggcatatgctcaccaagaataagccattaaggaattag

DBGET integrated database retrieval system