KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_4532Help
Entry
Dhaf_4532         CDS       T00822                                 

Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K07516  
3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
Fatty acid degradation
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dhd01200]
Metabolism; Overview; Fatty acid metabolism [PATH:dhd01212]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:dhd00720]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:dhd00071]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4819776..4822163)
Genome map
AA seq 795 aa AA seqDB search
MAIYKVAVLGSGVMGSTIAAHLANAGIPSILLDIVPPSLLPEEEAAGLTLASPQVRNRFA
ASNKAKLIKMNPAPLFVPEFADRIEVGNFEDDLPRLQEVDWVIEVVVERLDIKIDLFKKV
AQHVRPGTIVTSNTSGISLKSMTEGLPEEFTKSFFGTHFFNPPRYMKLFELIPGPNTDPT
VIQEMEEFAERVLGKGVVYAKDTPNFIANRIGVFGLAATIREMQRSGLTIDEVDALTGPV
MGRPKSASFRTVDMVGLDTFVHVANNVGDNVPEEKEFFVMPDFIHTMIKNGWLGDKSKQG
FYKKVKTAEGKEVLVLDPHTMEYVPKKKVKFACLDKAKNAGGLKDKMKTLVNGKDPGAEF
AWNVLKEVLLYAARLAPQIADDLTALDAGMKLGFNWEMGPFETWDALGVKATAERIAAEG
GTLPEIVAKLLAEGKDSFYEKTEGGDTLYYAGGEYKEKAASPYSFSLKKAHKQGKKIFGN
SGASLVDMGDGVACLEFHSPNNSIGGDIMNMIHKSLAEVEKNYLGMVIGSQGKNFAVGAN
LMLIMMEAEEGNWDDLDLMVREFQRGTMALKYAKKPVVAAPYGMTLGGGTEVCLHSHAIQ
PAAETYMGLVELGVGLIPGGGGTKEMALRAMEGILPGVVVAPDYFFAKRFEVVAMAQVST
SAEMARKLGFLRASDRCSMNADHVLLDAKARVLDLARDFRPIIPQKVKAAGPGVCAFLEM
ALYGMKEGRYISEYDAHLGKKLAYAMTGGDVLAGTLVDEQYLLDLEREVFLSLAGEPKTL
DRIRHMLTKNKPLRN
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggccatctataaagtggcggttttaggctcaggggttatgggaagcaccatcgcggcc
catctcgccaatgccgggattcccagtatactgctggacatagtaccccctagtttgttg
ccggaggaagaagcggccgggctgaccttggcatccccccaagtcagaaatcgttttgcc
gcatccaacaaagccaaactcatcaagatgaaccctgctccgctgtttgtgccggaattt
gcggatcgcatcgaagtcggcaattttgaggatgatctgccccgtttgcaagaagtggac
tgggttattgaagtggtcgtagagcgtttggacatcaaaatcgacctctttaagaaggtg
gcccagcatgtccgcccggggaccattgtaacatccaacacttccggtatttctttaaaa
tccatgacagaagggcttcctgaagaatttaccaagagctttttcggcacccacttcttt
aatcctccccgttatatgaagctttttgaactgattcccggacccaacacggatccgacc
gttattcaggagatggaagagtttgccgagcgggtgctgggcaaaggggtcgtctatgct
aaggatacgcccaacttcatcgccaaccgcatcggcgtctttggtttggcggcaaccatc
agagagatgcagcgttccggcttaaccatcgatgaagtggatgctttaaccggaccggtg
atgggacgtcctaagtcagcctccttccggaccgtggatatggtgggtctggacaccttt
gtccatgtcgccaataacgtgggagataatgtccctgaagaaaaagagttcttcgtcatg
ccggactttattcataccatgatcaaaaacggctggctgggagataagagcaagcagggg
ttctataaaaaagtcaagacagcagaaggcaaagaagtactggttcttgatccccatacc
atggagtatgttcccaagaagaaagtcaaatttgcctgcctggataaagccaagaatgcg
ggcggtcttaaagataagatgaaaaccttggtcaacggcaaagatcccggggctgaattc
gcctggaatgtcttgaaggaagttctcctttatgcggcccgcctggctccccaaatcgcc
gatgatcttacagctcttgatgccggtatgaagctgggcttcaactgggaaatgggacca
tttgagacctgggatgccttaggcgttaaagccaccgcggagcgcatcgcagctgagggc
gggaccttgcctgagatcgtggcaaaactgctggctgaaggcaaagacagtttctatgag
aagaccgaaggcggggacactctgtactatgccggaggcgaatataaggaaaaggccgcc
agcccctattccttctcccttaaaaaggcccataaacaaggcaaaaaaatcttcggcaat
tccggtgccagcttagttgatatgggtgacggtgtagcctgcctggaattccattcaccg
aacaactccatcggcggggatatcatgaacatgattcacaagtccttggcagaggtggaa
aagaactatttagggatggtgatcggcagtcagggtaagaatttcgccgttggtgccaac
ctgatgctgattatgatggaagcggaagaaggcaattgggatgacctggatctcatggtc
cgcgaattccaaaggggaaccatggccctgaaatacgccaagaagcctgtggtagccgct
ccctatggcatgactttaggcggtggaactgaggtttgcctccattcccatgccatccag
cctgcggctgagacctatatgggcctggtggagctgggcgtgggcctcatccccggcggc
ggcggcaccaaggaaatggccctgcgcgctatggaaggaattcttcccggcgtggtcgtt
gctccggactatttcttcgccaaacgcttcgaagtagtggccatggcccaggtttccacc
agtgcggaaatggccagaaagcttggcttcttaagggcaagtgatcgctgcagtatgaat
gccgaccatgttctcctcgatgccaaggcccgtgtccttgatctggcaagagacttccgc
cccatcattcctcagaaggtcaaagcagcaggaccgggagtctgtgccttcctggaaatg
gccctgtatggcatgaaagaggggcgttatatctccgaatacgatgctcacttagggaaa
aaactggcttatgccatgaccggcggcgatgttctggccggaactttggtggatgagcaa
tatctcctggatctggaaagagaagtgttcttaagccttgccggagaacccaagactctg
gatcgcatccggcatatgctcaccaagaataagccattaaggaattag

DBGET integrated database retrieval system