KEGG   Desulfitobacterium hafniense DCB-2: Dhaf_4892Help
Entry
Dhaf_4892         CDS       T00822                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K00132  acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
dhd  Desulfitobacterium hafniense DCB-2
Pathway
dhd00620  Pyruvate metabolism
dhd00650  Butanoate metabolism
dhd01100  Metabolic pathways
dhd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dhd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dhaf_4892
   00650 Butanoate metabolism
    Dhaf_4892
Enzymes [BR:dhd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Dhaf_4892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh BORCS7
Motif
Other DBs
NCBI-ProteinID: ACL22886
JGI: Dhaf4892
UniProt: B8G0F0
Position
complement(5214617..5216104)
Genome map
AA seq 495 aa AA seqDB search
MLNFDYDLQSVQETRNLARQAKQAQTELAQFNSEQIDKIIRNMVKVAEENAVALAKLAVE
ETGFGKVEDKVFKNRFASTELYQFIKPMQTIGVIKEDKINKVMEIAEPVGLLMGIVPSTN
PTSTTIYKSLIAIKARNGIVFSPHPSALKCTLEAAKLMNDAAVAAGAPANIIGCISKPSM
NATNELMKCDEVAMIIATGGSAMVKAAYSAGKPALGVGPGNVPAYIERTADIPKAVRNII
ASKTFDNGTICASEQSVVVEECIRNQVMEEFKRQGGYFMTPEETEQVGRKLFNRGHAMNA
KMVGRSAADIAAGAGISIPPGTKVLLGEQQGVGEQYPLSYEKLTTVLAFYTVKDWHEACD
LCMKLLNNGGVGHSLSIHTENPEMAIKFAEKPVFRILVNTASTHGGVGVSTGLAPAFTLG
CGTWGGSATSDNVTPMHLINIKRVAYGIKDVTENGNSSYATGDAQQGGSGGTVSEDRIQA
LVNEVMSLLKQRGDC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaactttgattatgatttacaatctgtgcaggagaccagaaatcttgcccgtcag
gccaaacaagcccagactgaactggcacaattcaatagcgagcagattgacaaaatcatt
cgcaatatggtaaaggtagcggaggaaaatgctgttgctctggcaaagttagcggtggaa
gaaacagggtttggcaaagtggaggataaggtttttaagaatcgttttgcctctacagag
ctctatcaatttatcaagcccatgcagaccatcggggttattaaggaagacaagatcaat
aaggtcatggagattgcggaaccggtgggattgctgatggggattgtcccctccaccaac
cctacctccacgactatctacaaatcgctcattgccattaaagcacgtaacggaattgtg
ttctcaccccatccttcggctttgaagtgcactttggaagcagctaagttgatgaacgat
gcggcagtggcggccggtgctccggccaatatcatcggctgcatctccaagccatccatg
aatgcaaccaatgaactcatgaaatgcgacgaagtagccatgatcattgccacaggcggt
tcggccatggtcaaggcggcctatagcgccggaaaaccggctctgggggtaggcccgggc
aatgttcccgcttatattgaaagaactgccgatattcccaaagcagtcagaaatattatt
gccagcaaaaccttcgacaatggcactatctgtgcttctgagcaatcggtggtggtagaa
gagtgcattcgcaaccaggttatggaagagttcaaacgtcagggcggctacttcatgacc
ccggaggaaactgagcaagtggggcggaaactgtttaacaggggccatgccatgaatgct
aaaatggtggggagatccgctgcagatatcgcagccggtgccggaatttccattcccccg
ggaaccaaagttctgctgggagaacaacagggagtcggcgagcaatatcccctctcctat
gaaaagctgaccacggtgctggccttttataccgtcaaagactggcatgaagcctgcgat
ctatgcatgaaattactcaataacggcggggtaggccatagcctttccattcatacggaa
aacccggaaatggctatcaaatttgcagagaaacccgttttcaggattttggtcaataca
gcatccacccatggtggtgtaggagtaagtacaggactggcgcccgcctttaccttaggc
tgcggtacttggggaggaagcgcaacctcagacaatgtaacccctatgcacttgatcaat
attaaacgtgtagcctatggaatcaaagatgtcacagagaatgggaattcctcctatgca
accggggatgcacagcagggcggctccggcggcactgtcagtgaagaccggattcaggct
ctggtcaatgaagtcatgtccctgttgaaacaaaggggtgactgctaa

DBGET integrated database retrieval system