KEGG   Desulfovibrio hydrothermalis: DESAM_20062Help
Entry
DESAM_20062       CDS       T02428                                 

Gene name
proB
Definition
Glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dhy01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dhy00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
343170..344312
Genome map
AA seq 380 aa AA seqDB search
MSRTNNRIQTLNEAKRIVVKIGSAVLTTSEGINLGLICRLADQLATLHERGVDIVLVSSG
AVAAGRNSIPSGARLDSLPARQAASAIGQSRLMHEYDETFRRFGLITSQVLLTRDDLKHR
DRFLNARNTLSRLLEWRVIPIINENDTVAVQELEFGDNDTLASLILNVVEADLFINLTSA
DGVFDKNPDKNPDAKPLAYIENVHDLDLDAMCDGKTAVGSGGMFSKMRAANRAAQLGVPT
LILAGKERMIIERVFNGEECGTWIVPDEKSVSRRKYWLAYHCDPSGDLIIDSGAQQALMA
GGKSLLPAGITDVNGNFKAGELVRVISLDGSPIAVGLSCYGSDDMRRIMGRKSNKIESIL
GKCSYPEAIHRDNLLLDAAL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaacgaacaacaggattcagacgcttaacgaagcaaaacgcattgttgtaaaa
atcggcagtgctgttctgaccacctcagaaggtatcaatctgggtctgatatgccggctg
gctgatcagctcgccactttgcatgaacgaggggttgatattgttcttgtctcttccggt
gcggttgctgccggacgaaattcaatcccgtccggtgccagacttgacagcctgccagcc
agacaggctgcatctgccatcggccagtcacggctcatgcacgagtacgatgaaactttt
cgcaggttcggcctgatcacctcacaggtgctgcttacccgtgacgacctcaaacacagg
gatcgtttcttaaatgcccgtaacaccctttcaagacttcttgaatggcgggtcatcccc
attatcaacgagaacgataccgttgcagttcaggagcttgaattcggggacaatgacacc
cttgcaagcctgattctgaacgtggttgaagcggaccttttcatcaacctgacttctgcc
gatggtgttttcgacaaaaatcctgataaaaatcccgatgcaaagcccttggcttacatt
gaaaatgtccatgatcttgatctggatgccatgtgtgacggcaagactgctgtaggttcc
ggcggcatgttctccaaaatgcgggcagcaaacagagctgcacagcttggagttccgact
cttattcttgccggaaaagaacgcatgatcattgaacgagtctttaacggagaagagtgc
ggaacatggatcgtgccagatgaaaaatccgtatcccgccgaaaatactggctggcatat
cactgcgacccttccggcgacctgatcattgattcaggtgcgcaacaagctctcatggct
ggcggaaaaagcctgctcccggcaggtataactgacgttaacggaaacttcaaagcaggg
gaacttgtgcgtgtgataagccttgacggcagccccattgcggtcggcctatcatgctac
ggctctgacgatatgcgcagaataatgggccgaaaatctaacaagattgaatccattctt
ggcaaatgctcctaccctgaagcaattcaccgggacaatttactgcttgatgctgctctg
taa

DBGET integrated database retrieval system