KEGG   Desulfovibrio hydrothermalis: DESAM_20271Help
Entry
DESAM_20271       CDS       T02428                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DESAM_20271
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DESAM_20271
Enzymes [BR:dhy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     DESAM_20271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
582934..583800
Genome map
AA seq 288 aa AA seqDB search
MKDLTLVFPQWQGAIDNMALFDGAVLLAENIPGLPAVSTVEIPPLKALKTCDSIAGKGDI
VSQLGSACKTIKTENPDRILLLGGDCSTETGPVSWMNEKYSDRLALIWFDAHPDLNTPLT
TKSGRMQGMALSAILGNGGMDITKTMFKPLMPRQVFCAGVREFDPPELDFITENKIPFFG
PGELERDPAWLAKQICKAGFSKVYIHIDVDAINPMGFPHSKPSPPAGLPFGRTLKMIEEI
KNRLDICGLGLTEFHPGNERGVEKVQELIITALDGFLLGEGLIATKDH
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaccttaccctagtattcccgcaatggcagggggccatcgacaatatggcttta
tttgacggggctgttttgctggcagaaaacataccggggctgcctgcggtcagcacagtc
gagatcccaccgcttaaagcgcttaaaacctgcgattccattgcgggcaaaggggacatc
gtcagccagttgggaagtgcgtgcaaaaccatcaaaactgaaaaccccgaccgcatactt
cttctgggcggggattgcagtacggaaacaggtccggtttcatggatgaacgaaaaatat
tcagacaggctggccctgatctggtttgacgctcaccccgatttgaacaccccgctgacc
acaaaatcaggccgcatgcagggtatggccctttccgcaatactcggtaatggagggatg
gacataacaaaaaccatgttcaaaccgctcatgccgaggcaggttttctgcgccggagtc
agagaattcgatccgccggagctggattttatcaccgaaaataaaataccgttcttcgga
ccgggtgagcttgaaagagaccctgcatggctggccaaacaaatctgcaaagccggattc
agcaaagtatatattcatatagatgtagatgctatcaacccgatgggatttcctcacagc
aagccgtcaccccctgctggattacccttcggaagaactcttaaaatgatagaagaaatt
aagaacaggcttgatatatgcggacttggactcactgaatttcatcccggaaatgaaaga
ggagtcgaaaaggtacaagagctgattattacagccttagacggttttcttctcggagaa
ggcctgatcgcaacaaaagaccattaa

DBGET integrated database retrieval system