KEGG   Desulfovibrio hydrothermalis: DESAM_20561Help
Entry
DESAM_20561       CDS       T02428                                 

Gene name
algC
Definition
(GenBank) Phosphomannomutase/phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
dhy00010  Glycolysis / Gluconeogenesis
dhy00030  Pentose phosphate pathway
dhy00051  Fructose and mannose metabolism
dhy00052  Galactose metabolism
dhy00230  Purine metabolism
dhy00500  Starch and sucrose metabolism
dhy00520  Amino sugar and nucleotide sugar metabolism
dhy00521  Streptomycin biosynthesis
dhy01100  Metabolic pathways
dhy01110  Biosynthesis of secondary metabolites
dhy01120  Microbial metabolism in diverse environments
dhy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DESAM_20561 (algC)
   00030 Pentose phosphate pathway
    DESAM_20561 (algC)
   00051 Fructose and mannose metabolism
    DESAM_20561 (algC)
   00052 Galactose metabolism
    DESAM_20561 (algC)
   00500 Starch and sucrose metabolism
    DESAM_20561 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    DESAM_20561 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    DESAM_20561 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DESAM_20561 (algC)
Enzymes [BR:dhy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     DESAM_20561 (algC)
    5.4.2.8  phosphomannomutase
     DESAM_20561 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: CCO22848
UniProt: L0R7Y1
Position
870628..871995
Genome map
AA seq 455 aa AA seqDB search
MKDINSEIFRAYDIRGIVGQDFDEEWVENLGRSCGTWFLSKGWNRAVVGHDCRHSSPAYQ
AAITRGLNASGVDVLFLNLVPSPVLYFAARKLNYKAGVMITASHNPPEFNGFKIWGNDTT
IHTDDIQQICQIMKSGNFAEGSGIASHHDIVPYYIEDLLSGIKIKRPVKIVLDGGNGAGG
HIALKLLRQAGAEVIPLYCTPDGDFPNHHPDPVVEAYMGDLLKAVVEHGAEAGIGLDGDA
DRIGAVDENGRLMPGDRLLAIYAREMLSRKPGETVVADVKCSHLLFEDIEKHGGRQIMAR
TGHSIMKAKMAETGAGLGGEMSGHIFFADRFYGFDDGIYSALRLIEILAHEKQPLSKMLS
DWPETFFTPELRIDCPEKIKFELVEKAAQRLAEEYNVIDIDGVRVVFEDGWALVRASNTQ
AALTLRFEASSAKRMEEIKGIIESLLDKLTHELTG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatattaacagcgaaattttcagagcctatgatatccgtggcatagttggtcag
gatttcgatgaagagtgggtggaaaatctaggccggtcctgcggcacatggtttctgtcc
aagggctggaaccgcgcagtggtgggccatgattgcagacacagctccccggcctatcag
gctgctattaccagagggcttaatgcaagcggagtggatgttctttttctgaaccttgtt
cccagtcccgtgttatattttgcggccagaaagctgaactacaaagccggagtgatgata
acggccagccacaatccccctgaattcaacggatttaaaatctggggtaatgatacaacc
attcatactgacgatatccagcagatctgccaaatcatgaaatccggtaactttgccgaa
ggttcaggcatagcttcccatcatgatattgtgccttattatattgaagatctgctttcc
ggtatcaaaataaaacgaccagtgaaaattgttttggacggcggcaacggggccggcgga
cacatagccctaaaactgctgcgtcaggccggagcagaagtaatccctttatattgtaca
ccggacggagattttccaaaccatcatccggaccctgtagttgaagcctacatgggagac
ctgcttaaagctgtagttgaacacggggccgaggccggaataggtctggacggcgatgct
gaccgcatcggagccgttgatgaaaacggcaggctcatgcccggcgacagactgcttgcc
atctatgcccgagaaatgctcagccgcaagcccggcgaaacagtcgtggccgatgtaaaa
tgcagccatcttttatttgaggacattgaaaaacatggcggcaggcagattatggcccgc
acaggtcattccattatgaaagcaaaaatggctgaaaccggagcgggactgggcggtgaa
atgagcgggcatattttctttgccgatcgtttctacggttttgatgacggaatatactcc
gccctgcggctgattgaaattctagcccatgaaaaacagcccctgtcaaaaatgctaagt
gactggccggaaacttttttcactcctgaattacgcatagactgtccggaaaaaattaaa
tttgagctggttgaaaaagctgcgcagcgactggcagaagaatacaatgtcattgatatc
gacggggtgcgcgttgtttttgaagatggatgggcactggtaagagcctccaacactcaa
gcggcacttacactgcgtttcgaagcgtcatctgcaaagcggatggaggagatcaaaggt
ataattgaatcacttctggacaaactcacgcatgaattgactggttaa

DBGET integrated database retrieval system