KEGG   Desulfovibrio hydrothermalis: DESAM_20696Help
Entry
DESAM_20696       CDS       T02428                                 

Definition
putative Asparagine synthetase [glutamine-hydrolyzing] 1 (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dhy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1007536..1009380)
Genome map
AA seq 614 aa AA seqDB search
MCGIIGAVNSSAGLDLATLHHRGPDGQGQWNDGSFCRLGHTRLSIIDLDTRASQPMVSRS
GRFVIVFNGEIYNYRELKKDFFPDFDFRTTSDTEVLLELWEAMGPDSLSHLRGMFGFAIW
DKKEKELFLARDRMGKKPLVFSCGNGSMSFASELDALVSLLPQKPEIDPRAMDLFLAYQF
IPHPFTIYKGCEKLPPAHFARFKDGQLKIERYWSINFKPDYSISEDEAFEQLEEQVKEAV
RLRMRSDVEVAVLLSGGVDSSLVAAVAAKESGMRLKTFSVGFDYGKSELEHAAKAALACN
SIHRPASLDEKTAGSLFDDMVNAYGEPYGDNSALPSLFVCAHAASEVKVALNGDGGDELM
GGYGKYNPKFMRRLMTPFASFGYKAGCTLDNFVNKRFSSPEVLKLADRMGSSFSPYIKVV
RFNHFFSSQYRKGLYRPEIFSEVLEIRSEYEQKLISELPLTGPLMCRLQNIDYRHYFVCD
LLVKMDIAGMRNSLETRSPLMDHKLFEFAATLPPQYKIKNGETKYLLKKLAAKYLPREII
YRPKAGFSVPVGNWAETIFKHKVAGAASNPNHPLWNYLNRDYVKKMTEGSPGQVRRNGHR
LWLLSVLCRWTETH
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattatcggagctgttaattcctcagcgggactggaccttgccacgcttcat
catcgcggtcccgacggacagggacagtggaatgacggcagcttctgccgtcttggtcat
acccgtttatccattattgatctcgatacccgcgcttctcagcctatggtcagccgtagc
ggtcgatttgtcattgtgtttaatggcgagatctacaattatcgggaactgaaaaaagat
ttttttcctgactttgatttccgcaccacgtccgataccgaggtgctgcttgaactgtgg
gaggctatggggcctgattctttaagccatttgcgggggatgttcggctttgccatctgg
gataaaaaggagaaggagctttttctagcccgggacagaatgggtaaaaagcctcttgta
ttcagttgtggaaacggttccatgagtttcgcttccgaacttgatgcactggtcagtctg
cttccgcaaaagccggaaattgatcctagggctatggatttgtttctcgcttatcaattc
attccacatccgttcactatctataaaggttgcgaaaagcttcctccggctcattttgct
agattcaaggacggccagctcaaaattgaacgctactggtcaataaacttcaaacctgac
tactctattagtgaagatgaagcctttgagcagcttgaagagcaggtcaaagaggcggtc
aggctgcgaatgcgttctgacgtagaagtagctgtactcctgagcggcggggttgattcc
agccttgttgctgcggtagcggcaaaagagtcaggcatgcgccttaaaactttttcggtt
ggatttgattatggcaaaagtgaacttgagcatgccgctaaagccgctcttgcctgcaat
tcaatccacaggcccgcatccctcgacgaaaagacagccggttcattatttgatgacatg
gtcaatgcttacggtgagccgtatggcgataactcggcacttcccagtctgtttgtctgt
gctcatgcagcttcggaagtaaaggttgccctgaacggcgatggcggtgatgaacttatg
ggcggctacggcaaatacaatcccaagttcatgcgccggctcatgaccccttttgcttca
ttcggttataaggccggatgcaccttggataacttcgtcaataaacggttcagctcaccg
gaagttcttaagcttgccgaccgtatgggatcaagtttctccccgtatataaaagttgtg
cgtttcaaccatttcttttcatcacaataccgcaaaggtctttatcggccggagatattc
agcgaagtactcgaaatacgttccgagtatgagcaaaagctgatctctgaactgcctctc
accggtccgcttatgtgccggttgcaaaatatagactaccgtcattatttcgtctgtgac
cttttagtaaaaatggatattgccggaatgcgtaattctctagaaacgcgttctccgctc
atggatcataagctatttgaatttgcggcaactttgcctccgcaatacaagataaaaaat
ggcgagacaaaatatctgctcaagaaacttgctgcaaaatatctgcctcgcgaaataatc
tatcggcccaaagcaggcttttcagtgccggtaggcaactgggcggaaacaattttcaag
cacaaggttgccggggctgcaagcaaccccaaccatcccttgtggaattatttaaaccgt
gattacgttaaaaaaatgaccgaaggcagccccggacaagtgcgccggaatgggcacagg
ctttggctgttatcagtgctctgccgttggactgagacgcattag

DBGET integrated database retrieval system