KEGG   Desulfovibrio hydrothermalis: DESAM_20710Help
Entry
DESAM_20710       CDS       T02428                                 

Gene name
pyrB
Definition
Aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dhy00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dhy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1022844..1023770
Genome map
AA seq 308 aa AA seqDB search
MEWQHKDLLDITQLNKEEVQHVFETATYFQEINSRPVKKVPTLKGHSVVLFFAEPSTRTK
VSFDMAGKRLSCDTFSLAKSSSSLTKGETLKDTALTLQAMNPDGIVLRHWASGSAAFLAE
RLDCSIINAGDGRHAHPTQALLDGFTLYQEWGSLEGKTVLILGDIAHSRVARSNVILLTM
MGAKVRLCGPRTLLPPYLKNWPVKVYSDINEACKGTHAIMCLRLQLERQQAGLLPDTREY
SRYFGLGYRQMELASPDVKVMHPGPMNRGVEISSELADSAASLVLDQVASGVATRMALLY
LYLTRQKQ
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaatggcagcataaggatttgctggatattacccagctcaataaagaggaagtgcag
catgtttttgaaacagccacttactttcaggaaatcaactcccgtccggtcaagaaggta
ccgacacttaaaggccatagcgtggtccttttttttgccgaacccagtaccagaacaaaa
gtttcttttgatatggccggtaaaagactatcctgtgatactttctcccttgctaaaagt
tcaagcagtctgaccaaaggtgagacacttaaagataccgccctgaccttgcaggccatg
aaccctgatggaattgttctaaggcactgggccagcggatcggcagcattccttgctgag
cgactcgattgcagcattatcaatgccggagacggccgtcatgcccaccccacacaagcc
ctgctggacggctttaccctctatcaggaatggggaagccttgaaggtaaaacagtactc
attctcggcgatatcgcccatagcagggttgcccgttccaatgtgatcctgctgaccatg
atgggcgcaaaagtacgcctttgcggtccgcgcactctgctgcctccataccttaaaaac
tggccggtcaaagtatactccgacattaatgaggcctgcaaagggactcatgccatcatg
tgcctgcgcttgcagcttgaacgccagcaggcgggactgcttcctgatacccgtgaatat
tccagatatttcggtcttggctacagacagatggagcttgcctcccctgatgttaaggtt
atgcatcccggtcccatgaacagaggcgttgaaatcagttctgaacttgctgactctgcg
gcgagccttgtacttgatcaggttgccagcggtgtcgccacccgtatggctcttctttat
ctctacctaacccgccaaaaacaataa

DBGET integrated database retrieval system