KEGG   Desulfovibrio hydrothermalis: DESAM_20847Help
Entry
DESAM_20847       CDS       T02428                                 

Gene name
cheB
Definition
Chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DESAM_20847 (cheB)
Enzymes [BR:dhy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DESAM_20847 (cheB)
Two-component system [BR:dhy02022]
 CheA family
  WspE-WspRF [MD:M00509]
   DESAM_20847 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1168390..1169418)
Genome map
AA seq 342 aa AA seqDB search
MRIAIVNDMGIAVEVLKKVITSAGYEIAWIARNGERAIEKCCADVPDIVLMDLNMPVMDG
AEATRRIMKKCPCSILVVTASIENNASKVFEAMGAGALDVVATPELGTDGALKGDSNLIS
KISVLSKLQNNGKHSHIDPKPRLRSRARPPLLAIGSSTGGPSALATLLGDLPEDFPAAIA
IVQHVDGQFSENLAQWLDSQTEIKVSLARNGEMLQAGQAVIAPGDTNMLMRPGGTVQITP
NSDGNLYVPSVDLFYDSLCCAGFPANSAAVLLTGMGADGAKGLLELKNSGWLTIAQDEKS
SVVWGMPGAAVKLNAAREICSINDMARILTRHFNKRFQEKVT
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgagaatagcaattgtcaatgatatgggcatagccgtggaagtactcaaaaaggtcatc
acttctgcgggatatgaaatagcatggattgcccgtaacggcgaacgcgctattgaaaaa
tgctgtgctgatgtgccggacattgtgctcatggacctgaacatgccggtcatggacggg
gccgaggccacccgccggattatgaaaaaatgcccctgctccatacttgtagttaccgca
agcatagaaaataatgcttccaaagtttttgaagcaatgggggccggagcactggacgtg
gtagccactccggaacttggaactgacggagctttaaaaggagactccaatttaatttca
aaaatttcagtgctcagcaaattacagaacaacggcaaacactctcacatagatcctaaa
ccccgtttacggtccagagcaaggccgccgcttctggctataggcagctccacgggagga
ccatcggctcttgccacactgctcggggatctgcccgaggattttccggctgcaattgcc
attgtgcagcacgtggacggacagttttctgaaaatctggcccaatggctggacagccag
actgagataaaagtgtctcttgcccgcaacggcgagatgttacaggcggggcaggctgta
attgcccccggtgataccaatatgttgatgagaccgggcggaacagtgcagatcactccc
aattccgacggtaatttatatgttccttccgtggatttattttatgacagcctgtgttgc
gccggatttccagccaactcagccgctgtgctgttaaccggaatgggagcagacggcgca
aaaggactgcttgaacttaaaaattcaggctggctgaccattgctcaggatgaaaaatcc
agtgttgtctggggcatgcccggagcagcggtcaaacttaatgcggctcgcgaaatatgt
tctattaatgatatggccagaatcctgaccagacattttaataaaagatttcaggagaaa
gtaacatga

DBGET integrated database retrieval system