KEGG   Desulfovibrio hydrothermalis: DESAM_20962Help
Entry
DESAM_20962       CDS       T02428                                 

Definition
(GenBank) Asparagine synthase (Glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
dhy00250  Alanine, aspartate and glutamate metabolism
dhy01100  Metabolic pathways
dhy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DESAM_20962
Enzymes [BR:dhy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     DESAM_20962
Peptidases [BR:dhy01002]
 Cysteine Peptidases
  Family C44
   DESAM_20962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase DUF3700 QueC DUF1933
Motif
Other DBs
NCBI-ProteinID: CCO23249
UniProt: L0R917
Position
complement(1301381..1303336)
Genome map
AA seq 651 aa AA seqDB search
MCAIAGLIDFSHSTGTGQLERIARKMGEAQNHRGPDGHGQWSDPESGIALDHRRLAIIDL
TDEGVQPMHSCSRRYVTVFNGEIYNYRELRAKLEQAEGFRGWRGHSDTEVMLEAFEQWGF
EKAVKSFNGMFSIALWDRENRQLFLARDRMGEKPLYYSNQGDTFLFGSELKALMAHESFV
KNIDRHSLASYLRYHYVPAPRTIFKDVHCLMPGTWIIIQPDGSISEPQQYWSLLDCARDA
ENKIFTAPDENIIETLEDLLLKVIEREMISDVPLGAFLSGGIDSSLIVALMQQCALSPVK
TFTIGFDDEAYNEADDAKAVARHIGTEHTELYVSPKDALDIIPQIPHIWDQPFSDASQIP
THLVSRMTREHVTVALSGDGGDELFAGYNRHIKGASLWHKLKNVPIPLRIIGARSIANIS
PASWDRVFKMYEPLLPTGLQMRLPGQKLHKLADVMAAESAAEYYKAITSNWQNPEDAVPD
REFNSPFQNTDMQPSQNNLTAWMQYMDAATYLPDDILTKVDRAAMAVSLETRAPFLDHEV
VEFSQRLPMHLRIQNGHGKHALRQILYKHVPRELIERPKMGFGIPIDSWLRGPLREWAEG
LISPNRLELDGFFNIGEIRRIWNEHLSGKKDNQYRIWNILVFQSWLDHWDI
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcaatagccggactcattgatttttcacacagcaccggcaccggacaactcgaa
agaattgcccggaaaatgggtgaagcccaaaaccatcgaggccctgacgggcatggacaa
tggtccgatccagagtccggcatagcacttgatcaccgccgtcttgccatcatagacctt
accgatgaaggtgtgcagcccatgcacagctgctccagacgctacgttacggtttttaac
ggtgagatatataattatcgtgaacttcgagccaagctggaacaagctgaaggattcaga
ggctggcgcgggcattctgatacagaagtaatgctcgaagcattcgaacaatggggcttt
gaaaaagctgtaaaatcttttaacggtatgttttccattgccctctgggatcgcgaaaac
agacagctttttctcgccagagaccgcatgggagaaaaaccgctctactactccaaccaa
ggtgacacctttcttttcggctcagaactcaaagccctcatggcccacgagtcctttgta
aaaaatattgaccgccactcgctggcatcatacctgcgctatcactatgtaccggctccg
cgcacaatattcaaagacgtccattgcctcatgcccggcacatggatcataattcagcca
gacggttcaatatctgagccgcaacaatactggtctcttttagactgcgcccgtgatgct
gaaaacaaaatattcactgcgccggatgaaaatatcatcgaaactcttgaagacctgctg
ctcaaggtgatcgaaagagaaatgatatctgatgtgccgctcggagccttcctttcaggt
ggtatagactcctcgcttatcgttgcccttatgcagcagtgcgctctgtctccggtcaag
acctttaccatcggctttgatgacgaagcatacaacgaagcagatgatgcaaaagccgtt
gccagacatatcgggactgaacacaccgagctgtacgtctcccccaaagacgctcttgat
atcatccctcagattccccatatatgggatcagcctttttccgatgcctcacagattcca
acccatctggtctcccgcatgacccgcgaacacgtaaccgttgctctgtccggagatggc
ggtgacgaacttttcgcaggttacaaccggcacatcaagggagcttcgctctggcacaaa
ctcaaaaatgtcccgattccgctgcgcataatcggcgcgcggtccattgcaaatatttcc
cctgcaagctgggatagagttttcaagatgtacgaacctctattgccgaccggcctgcaa
atgcgtctgcccggacaaaagctgcacaaactggccgatgtaatggctgctgaatctgcc
gcagaatattacaaagccatcacatccaactggcaaaaccccgaagatgcagttccagac
agagaatttaacagcccgttccaaaacacagacatgcagccttcacagaacaacctgacc
gcatggatgcagtacatggacgccgccacttatctgcccgacgatatcctcaccaaggtg
gatcgggccgctatggctgtcagtcttgaaacccgcgcgccttttctcgatcatgaggta
gttgaattctcgcagcgactgcccatgcatttgcgcattcagaacggacatggcaagcat
gccctgcgccagatactatacaagcatgtgcccagagagcttattgaacgacctaaaatg
ggattcggtattcccattgacagctggctgcgcggacccttgcgcgaatgggccgaaggg
cttatctccccgaacagactggaacttgacggctttttcaatatcggagaaatccgccgg
atctggaatgagcacttaagcgggaaaaaagacaaccaataccggatctggaatatttta
gtcttccaatcatggcttgatcattgggatatatag

DBGET integrated database retrieval system