KEGG   Desulfovibrio hydrothermalis: DESAM_21556Help
Entry
DESAM_21556       CDS       T02428                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
dhy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dhy01100  Metabolic pathways
dhy01110  Biosynthesis of secondary metabolites
dhy01130  Biosynthesis of antibiotics
dhy01230  Biosynthesis of amino acids
Module
dhy_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DESAM_21556
Enzymes [BR:dhy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DESAM_21556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG FMN_dh QRPTase_C NanE His_biosynth DUF561
Motif
Other DBs
NCBI-ProteinID: CCO23833
UniProt: L0RAN2
Position
1918726..1919505
Genome map
AA seq 259 aa AA seqDB search
MLEKFRKSKQPEVDMLRKCEAEGTLPAPYEGQRISFADAVKRDESGMKVIAEYKRASPAK
GDINLGLSAADVAGMYARGGASAISVLTEHKYFKGDLSYLEEIKSCGLPMLRKDFLVDPL
QVVQTLSTPASALLVIVRMFADDDKLKEMIDKANECGLDAVVEAFDMTDLIRAKKAGAEI
IQINNRDLDTLGVDMSRSVEFIREKAEGEIWICASGIAEPEDCAQMARLGYDCVLVGTSI
MSSPDPQSKLAALVAGASS
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaaattccgtaaatcaaaacaaccggaagtggatatgctccgcaaatgtgaa
gctgaaggaacacttcccgctccatatgaagggcagcgtatttcctttgctgatgctgtt
aaacgtgatgaatcaggtatgaaggtcatcgctgagtacaagcgtgcttctccggcgaag
ggggatattaaccttgggctgagcgcggcggatgttgcggggatgtatgcgaggggcggt
gcttcagctatttcggtgcttactgagcataagtatttcaaaggtgatttgtcttacctt
gaagaaataaaatcctgcggcctgcctatgctgcgtaaagattttcttgtggaccccttg
caggttgttcagactttgtcgactcctgcttcagctctgcttgttattgtacgcatgttc
gctgatgacgataaactcaaagagatgatcgataaggctaatgaatgcggccttgatgca
gtggtggaagcgtttgacatgacggatctgatacgggctaaaaaagctggtgctgagatt
atccagattaacaaccgtgaccttgatacattgggtgttgatatgagtcgctctgtagag
tttatcagggaaaaggctgagggtgaaatctggatttgtgccagcggtatcgctgagcct
gaagattgtgcgcagatggctcggctcggctatgattgtgtactggtgggcacatccatt
atgtccagtccagatccgcagtctaaacttgctgcgcttgtggccggagcgtcctcgtga

DBGET integrated database retrieval system