KEGG   Desulfovibrio hydrothermalis: DESAM_21785Help
Entry
DESAM_21785       CDS       T02428                                 

Gene name
cheB
Definition
fused chemotaxis regulator ; protein-glutamate methylesterase in two-component regulatory system with CheA (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dhy02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dhy02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2147670..2148716
Genome map
AA seq 348 aa AA seqDB search
MINVVVVDDSAFMRKAISTMLEKDSGIKVVATARDGEEGLKVIRKYNPDVVTLDIEMPKM
DGLTALRHIMMEMPRPVLMVSSLTVEGAESTLKAMDLGAVDFIPKQLSKVSLDIVKIEND
LISKVKSVARRRMRPVPRMRTAARKPVTVPVRTNRGRPKRDVVMIGVSTGGPPAVQKILS
SLPKDFPAGIVIAQHMPKAFTGPFANRLNGVSQLKVKEAETGDRLLPGHVFVAPGGSHLI
IDQKVSRIDLVVTPNPKEALYKPSASVLATSVANAVGRRALGVILTGMGNDGRDGIRDLK
SKGGRAIAQSDSSCVVYGMPKAIVDDGLADEIVDIDDMANAIINNLYL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgataaatgtcgttgttgtagatgattctgcttttatgcgtaaagccatcagtactatg
ctggagaaagattccggtattaaagtggtggctacagcacgtgacggagaggaaggctta
aaggttatcagaaagtataaccctgatgttgtaacgcttgatatcgaaatgcctaagatg
gacgggcttacagcactacgtcatataatgatggaaatgccccgacctgtcttaatggtc
agctcattaactgttgaaggtgctgaatcaacgttgaaggctatggatctcggtgctgtt
gattttattccaaaacagctttccaaggtttctctcgacatcgttaagattgaaaatgac
ttgatttcaaaagtgaagtctgttgcaagacgccggatgcgtcccgttcctagaatgcgt
actgccgcccgcaaaccggtaaccgttccggtcaggactaatcgcggacggcctaagcgc
gatgtggttatgatcggtgtttctaccggcgggccgcctgctgtacagaaaattctttct
tcgctgcctaaggattttcctgcgggaatcgttattgcgcagcatatgcctaaagctttt
acaggcccttttgccaaccgcttgaacggagtcagtcagcttaaggttaaagaggcggaa
acaggggacaggcttttgcctggacatgtcttcgttgctccgggcggatcgcatcttata
attgaccagaaagtaagtagaatagatcttgttgtaacacccaaccctaaggaagctttg
tataaaccttccgcaagcgttcttgctacctcggttgcaaatgcggttggccggcgtgca
ctcggggtgattcttaccggaatgggcaatgatggccgtgatggaataagagaccttaag
agtaaaggtggcagggctattgcccagagtgattcttcctgcgttgtttatggtatgcct
aaggctatcgttgatgacggacttgcagatgagattgtagatattgatgatatggcaaat
gctattatcaataacctttacctgtaa

DBGET integrated database retrieval system