KEGG   Desulfovibrio hydrothermalis: DESAM_22010Help
Entry
DESAM_22010       CDS       T02428                                 

Definition
putative enzyme (EC:3.-.-.-)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dhy01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dhy00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2405619..2406839)
Genome map
AA seq 406 aa AA seqDB search
MPTQLLSKIDELKDTAIELHSKLVSIPAIGPDNNGSGEKEKADFIAAYLKDNGFGEVKSY
NAPDERVECGYRPNLVTVIPGQDSSRTLWIISHMDVVPVGDLSLWSSDPFTMIQDGDAIY
GRGVEDNHQGLVSSVIAAKALLQSGMTPGINLGLIFVSDEETGSEYGLEYMLKKHEDLFK
KKDLFLVPDFGEPDSSIVEIAEKSTIWFKVTVEGKQCHASTPDHGVNSLIAAAAMIVEIP
ELKFHFDEEDELFSPPYSTFEPTKKEANVENINTLPGKDIFYIDCRVLPNYELSEVIEQV
KGMALYVAEEYGVTINVEVETQNQAAPPTPVNSEIVDKVAFAINEVYGIEAKPGGIGGGT
VAAHLRERGYQTVVWATLLHQAHQPNEKGSIANTLNDAKVMALLPF
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcctactcagcttctgtccaagatcgacgaactgaaagatactgctatcgaacttcat
tcaaaactggtttccatccccgccataggcccagacaacaacggcagcggagaaaaagaa
aaagctgattttattgcagcctatcttaaggacaacggttttggcgaagtaaaatcatac
aatgctcctgatgagcgtgtggaatgcgggtacaggccaaacctagttacagttatcccc
ggtcaggacagctccagaacactctggattatatctcatatggatgttgtgcctgtaggc
gatttgagcctctggtccagcgaccctttcactatgattcaagacggcgacgcaatctac
ggacgcggagttgaagacaaccatcagggccttgtcagctctgtaatcgctgctaaggct
cttctccagtccggcatgacaccgggcatcaacctcggccttatttttgtttctgacgaa
gaaaccggaagcgagtacggccttgaatacatgcttaagaaacacgaagatctgtttaag
aaaaaagacctgttcctcgtaccggacttcggtgaaccagattccagcattgtggaaatt
gcagaaaaatccactatctggttcaaagtaactgttgaaggcaagcagtgccatgcatcc
acaccggatcacggagtaaattctcttattgccgcagcggcaatgattgtcgagatcccc
gaactaaaatttcattttgatgaagaagatgaactattctcaccaccatactccaccttc
gaaccaacaaaaaaagaagccaacgtagaaaatatcaacaccctgccgggcaaagatatt
ttctacatagattgccgggtactgcccaattatgagctaagcgaagtaattgaacaggtc
aaaggcatggccctgtatgttgcagaagagtatggtgtaacaattaacgtggaagttgaa
acacagaatcaggctgcacctcccacacctgttaattcagaaatagtagataaagtagct
ttcgctataaacgaagtatacggaatagaagccaagcccggcggaatcggaggcggcacg
gttgcagcacatctgcgtgaacgcggctatcagaccgttgtctgggccacattgctgcat
caggcgcaccagcccaacgaaaaaggttccatcgcaaataccctgaacgatgccaaggtg
atggcactgcttccattttag

DBGET integrated database retrieval system