KEGG   Desulfovibrio hydrothermalis: DESAM_22010Help
Entry
DESAM_22010       CDS       T02428                                 

Definition
putative enzyme (EC:3.-.-.-)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DESAM_22010
  Amino acid metabolism
   00300 Lysine biosynthesis
    DESAM_22010
Enzymes [BR:dhy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     DESAM_22010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2405619..2406839)
Genome map
AA seq 406 aa AA seqDB search
MPTQLLSKIDELKDTAIELHSKLVSIPAIGPDNNGSGEKEKADFIAAYLKDNGFGEVKSY
NAPDERVECGYRPNLVTVIPGQDSSRTLWIISHMDVVPVGDLSLWSSDPFTMIQDGDAIY
GRGVEDNHQGLVSSVIAAKALLQSGMTPGINLGLIFVSDEETGSEYGLEYMLKKHEDLFK
KKDLFLVPDFGEPDSSIVEIAEKSTIWFKVTVEGKQCHASTPDHGVNSLIAAAAMIVEIP
ELKFHFDEEDELFSPPYSTFEPTKKEANVENINTLPGKDIFYIDCRVLPNYELSEVIEQV
KGMALYVAEEYGVTINVEVETQNQAAPPTPVNSEIVDKVAFAINEVYGIEAKPGGIGGGT
VAAHLRERGYQTVVWATLLHQAHQPNEKGSIANTLNDAKVMALLPF
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcctactcagcttctgtccaagatcgacgaactgaaagatactgctatcgaacttcat
tcaaaactggtttccatccccgccataggcccagacaacaacggcagcggagaaaaagaa
aaagctgattttattgcagcctatcttaaggacaacggttttggcgaagtaaaatcatac
aatgctcctgatgagcgtgtggaatgcgggtacaggccaaacctagttacagttatcccc
ggtcaggacagctccagaacactctggattatatctcatatggatgttgtgcctgtaggc
gatttgagcctctggtccagcgaccctttcactatgattcaagacggcgacgcaatctac
ggacgcggagttgaagacaaccatcagggccttgtcagctctgtaatcgctgctaaggct
cttctccagtccggcatgacaccgggcatcaacctcggccttatttttgtttctgacgaa
gaaaccggaagcgagtacggccttgaatacatgcttaagaaacacgaagatctgtttaag
aaaaaagacctgttcctcgtaccggacttcggtgaaccagattccagcattgtggaaatt
gcagaaaaatccactatctggttcaaagtaactgttgaaggcaagcagtgccatgcatcc
acaccggatcacggagtaaattctcttattgccgcagcggcaatgattgtcgagatcccc
gaactaaaatttcattttgatgaagaagatgaactattctcaccaccatactccaccttc
gaaccaacaaaaaaagaagccaacgtagaaaatatcaacaccctgccgggcaaagatatt
ttctacatagattgccgggtactgcccaattatgagctaagcgaagtaattgaacaggtc
aaaggcatggccctgtatgttgcagaagagtatggtgtaacaattaacgtggaagttgaa
acacagaatcaggctgcacctcccacacctgttaattcagaaatagtagataaagtagct
ttcgctataaacgaagtatacggaatagaagccaagcccggcggaatcggaggcggcacg
gttgcagcacatctgcgtgaacgcggctatcagaccgttgtctgggccacattgctgcat
caggcgcaccagcccaacgaaaaaggttccatcgcaaataccctgaacgatgccaaggtg
atggcactgcttccattttag

  All links  
No link information was found.   
DBGET integrated database retrieval system