KEGG   Desulfovibrio hydrothermalis: DESAM_22108Help
Entry
DESAM_22108       CDS       T02428                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dhy00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:dhy00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:dhy02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2502705..2504258
Genome map
AA seq 517 aa AA seqDB search
MFKRIVRSMVLAVCLVMIAVTAFAGAPKYVFYFIGDGLGPTQRMAAELYNKLEKNDADAR
LVMNTFPQAALVTTYSDNTLITDSAAGGTALACGYKTTNGYIGKLPDGTDVKSIAEAAKE
NGYAVGIVTTTRLTHATPASFSAHNPDRNAANDIAVDQADSGFDFFAGGGYRHFVAKNNA
QGLKSKRKDNVDVVKMFTDQGYKVFVGDSTRDAFRAYKPKKGEKVFAALTYSHLPYEVER
RNSKVEKNKLPSLCELTEKAVESLSAQETPFFLMVEGGRIDHAAHAHDPKSTILDTIALD
EAVEVAYNFYKKHPEDTLIVTAADHETGGVALGISMDSKGYFLNLKELENVNVSAEDNLD
KYYNKLAKKESNLKKRHAAFIAYLEKEWGLTDRTPAEDKVLVNAMNVQDKNQHLPTDKQV
SYGYAYTPTMVAVTDLISQRARIFWTSFVHTGTFIPATSIGVGAEKFTGFIDNTDIPNRM
AEIMEVNLSDIKHIDSKALLGKTYGPQEKYAKIPYNK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaggattgttcgttcaatggttttggctgtctgtctggtgatgattgcggtg
accgcatttgccggtgcacccaagtatgtattttattttatcggggatggtcttggtccc
acacagcgtatggctgccgagctgtataacaaattggaaaagaatgatgcagacgcacgt
ctggttatgaacacttttcctcaggctgcactggttaccacttactctgacaacaccctg
attactgactctgctgccggcggtactgctttggcctgtggttacaaaaccactaacggt
tatatcggcaagctgcctgatggaaccgatgttaagtccattgctgaggctgcaaaggaa
aatggttatgctgtcggtattgttaccaccactcgtttgactcacgcaactccagcttct
ttctccgcacataatcctgaccgcaacgcagcaaatgatattgccgttgatcaggctgat
tccggatttgatttctttgcaggtggtggctaccgtcactttgttgctaaaaataacgct
cagggtttaaagtccaagcgtaaggacaatgttgatgttgtaaagatgttcacagaccaa
ggttacaaggtcttcgttggtgattccactcgcgatgctttccgcgcttataagccaaag
aaaggcgaaaaagtttttgctgctctgacttatagccatcttccctacgaggtggagcgc
cgtaacagtaaagttgaaaaaaacaagcttccttctctctgtgaactgactgaaaaggct
gttgagtctctttccgctcaggaaactcctttcttcctgatggtcgaaggcggacgtatt
gaccacgcagctcatgctcacgatcccaagtccaccattctggacacaattgctttggat
gaagctgttgaagttgcatataacttctacaaaaagcatcctgaagacactctcatcgta
actgccgccgaccatgaaacaggtggtgttgcactgggaatctctatggattccaaaggg
tatttccttaaccttaaggaacttgaaaacgttaacgtttccgctgaagataatcttgat
aaatactacaataagctggcaaaaaaagagtccaatcttaaaaaacgccacgctgctttc
attgcttatcttgaaaaagagtggggcctgaccgatcgtacccctgctgaagataaagtt
cttgttaatgcaatgaacgttcaggacaagaaccagcatctgccgacagataagcaggtc
agttatggttatgcttacaccccgacaatggttgctgtaaccgatctgatttctcagaga
gcgcgtatcttctggacttcttttgttcataccggaacatttattcctgcgacctctatt
ggtgtgggagcagagaagttcaccggctttatcgataacaccgatattcctaaccgtatg
gccgaaattatggaagtgaacctttctgacatcaaacacatcgattccaaggctctgctg
ggtaaaacttacggacctcaggaaaaatacgctaagattccttacaataaataa

DBGET integrated database retrieval system