KEGG   Desulfovibrio hydrothermalis: DESAM_22220Help
Entry
DESAM_22220       CDS       T02428                                 

Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DESAM_22220
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DESAM_22220
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DESAM_22220
Enzymes [BR:dhy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DESAM_22220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2620209..2621660)
Genome map
AA seq 483 aa AA seqDB search
MSLANTFPEYRAKMEYHCLGCNSRYDIKELHYTCPECGSVFILEDLTFDELKKTSGKEWR
ELFDARTATKKDSLRGIFRFYELFAAVMEEDEILYLGEGNTPIVASSPALNKITGIKTAY
KNDGQNPSASFKDRGMACAFSYINALLNKNNWDEILTVCASTGDTSAAAALYASYMGGPV
KSVVILPQGKVTPQQLAQPLGSGAKVLEVPGVFDDCMKVVEHLADNYRVALLNSKNSWRI
LGQESYAFEVAQWYDWDLKDKCIFVPIGNAGNITAVMAGFLKLYELEIINELPRLFGVQS
AHADPVYRYYSVNDPKEREYKPVTVQPSVAQAAMIGNPVSFPRVKHFAEKFEAIGGKNAF
QVVQVSEQQIMDSMLLANSNGHIACTQGGECLAGLIRAKELGLINENEMAVLDSTAHQLK
FVGFQDMYYQNDFPDEYEVTPDASKANKPELVIKSTEKDSLSEEQYISKAADNVVSMLGL
EKK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgccaataccttccctgaatacagggccaaaatggaataccactgtctgggc
tgtaactccagatatgacataaaagaactgcactacacatgcccagagtgcggatcagtt
ttcatccttgaagatcttacttttgatgaactgaaaaaaacaagcggtaaagaatggcgt
gaactcttcgatgcccgcacagctaccaaaaaagacagcctgcgcggcatatttcgcttt
tacgaacttttcgcagccgtcatggaagaagatgaaatcctctaccttggcgaaggcaat
acccctatagttgcatcaagtcccgcactcaataaaatcacaggcatcaaaaccgcctat
aaaaatgatggtcaaaaccccagtgcttcatttaaagacagaggcatggcttgcgctttc
agctacatcaacgccctgcttaataaaaataactgggacgaaattttaacagtctgcgct
tctacaggtgatacatcagcagccgcagccctttacgcctcctatatgggcggtccggta
aaatctgttgtgattctgccgcaaggtaaagtaaccccgcaacaacttgcacagccttta
ggcagtggcgcaaaggtacttgaagttcccggcgtttttgatgactgcatgaaagttgtt
gaacaccttgcggataattaccgtgtggctctgctcaattctaaaaactcgtggagaatc
ctcgggcaggaatcatacgcctttgaagttgctcaatggtatgactgggatctcaaagat
aaatgtatctttgtccctatcggaaacgcaggcaatataactgccgtcatggccggtttc
ctgaaactttatgaactggaaattatcaacgaactgcctcgtttattcggtgtgcagtcc
gcacatgctgatccggtctaccgttactattcagttaacgaccctaaagagcgcgaatac
aagcctgtcacagtccagccgtcagtggcgcaggcggcaatgatcggcaatccggtctcc
ttcccgagggtcaagcacttcgcggaaaaatttgaggctatcggcggtaaaaacgctttt
caggtcgtgcaggtttctgaacagcagatcatggattccatgcttcttgccaactcgaac
ggacacattgcctgtactcaaggcggtgaatgccttgcaggtttgatcagagctaaggag
cttggtctgattaacgaaaatgaaatggcagtgcttgattcaactgcgcaccagcttaaa
ttcgtcggttttcaggatatgtactatcaaaatgatttcccggacgaatacgaagttact
cccgacgcatcaaaggcgaacaagcctgaattggtaataaaatcaactgaaaaagattct
ctttctgaagaacaatatatatccaaagcagctgacaacgtcgtttccatgcttggtctg
gagaaaaaatag

DBGET integrated database retrieval system