KEGG   Desulfovibrio hydrothermalis: DESAM_22456Help
Entry
DESAM_22456       CDS       T02428                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DESAM_22456
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    DESAM_22456
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DESAM_22456
Enzymes [BR:dhy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DESAM_22456
Exosome [BR:dhy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DESAM_22456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2858043..2859557)
Genome map
AA seq 504 aa AA seqDB search
MKVSIKVRKLVMLLVCVMLMAAVPAQAKVKKVRVYKGQPAKYIFLFIGDGMGFPQKGATE
AFTGEQLMMNTFPAQGMTTTYAADRFITGSAAAATSLASGQKTNIGMLGMDPGQNHVKSI
AEMAKASGKKVGIVSSVSIDHATPAAFYAHVPTRGQYYDIDIALAESGFDFFGGGGLKDP
LNKKKNSRNFKGDALEVIKTAGYKVVTDKDEFLALKPADGKVISWNNWLQDSKALPYAMD
MGPEDITLPEFTGKAIEMLDNPEGFFLMVEGGKIDWACHANDAAAFIHNTISFDDSVKKA
VEFAKKHPKETLIVVTGDHECGGLTLGFAGTKYASHFNALKPQDVSFQKFSDEVVKLWKK
EHKNGASFEFFQPTITHFFGLEFDGDAKKNPMVVKGYQLAMLKDAYARTMKGEKKFKDPE
LYNLYGGYDPLTVSITHVLNNNAGLGWTSFKHTGVPVATSAMGVGSDSFNGYYDNVDVAY
KLMSIMGIAPKVYSKNSKVKVAVN
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttctattaaagtaaggaaattggttatgctgctggtgtgcgtaatgctcatg
gcagctgtgccggcgcaggcaaaagttaaaaaggttcgtgtctacaaggggcagcctgct
aagtacatttttcttttcataggtgatggtatggggtttcctcaaaaaggggctaccgag
gcttttaccggcgaacagttgatgatgaatactttccccgcgcagggaatgaccaccaca
tatgctgcggacaggtttattaccggttccgcagccgcagcgacatcacttgccagtggt
cagaaaacaaatataggcatgctcggtatggaccccgggcaaaatcatgttaaatccatt
gctgaaatggctaaagcttcgggtaaaaaggttggaattgtttccagtgtatcaattgac
cacgcaacacctgccgcattttacgctcatgttcctacccgcgggcaatattacgatatt
gacatagctctcgctgaaagtggttttgatttttttggcggtggaggacttaaagatcca
ttaaataaaaagaagaacagtaggaattttaaaggtgacgctcttgaggtcatcaagact
gccggctacaaagttgttactgataaagatgagtttctggctcttaaacctgcggatggt
aaggttatttcatggaataactggcttcaggattccaaggcccttccttatgctatggat
atggggccggaagatattactcttcctgaattcactggcaaggcgatcgaaatgctcgac
aatcctgagggattttttctgatggttgaaggcggaaaaattgactgggcctgccatgcc
aacgatgctgctgcttttattcataacactatatcttttgatgattccgttaaaaaagca
gttgaatttgctaaaaaacatccgaaggaaacccttatcgttgttaccggcgaccatgaa
tgtggcgggcttactctcggctttgccggaaccaagtatgcttcccattttaatgccctc
aagccgcaggacgtgtcgtttcagaagttctctgatgaagttgtgaagctctggaaaaag
gagcacaaaaatggtgcaagctttgaattctttcaacccaccattactcactttttcgga
cttgagtttgatggcgatgctaaaaagaatcctatggtcgttaaaggttaccagcttgct
atgctcaaagatgcatatgcccgcaccatgaagggtgaaaaaaagtttaaagatcctgaa
ttatataatctttacggaggttatgatcctttgactgtaagtatcactcatgttctcaat
aacaatgccggactcggctggacctctttcaagcacacaggagtacctgttgcaacctct
gcaatgggcgtaggctctgattctttcaacgggtattatgacaatgttgatgtggcatac
aagcttatgtccatcatgggtattgctcctaaagtttattccaaaaacagcaaagtgaaa
gtagccgtcaactag

DBGET integrated database retrieval system