KEGG   Desulfovibrio hydrothermalis: DESAM_22889Help
Entry
DESAM_22889       CDS       T02428                                 

Gene name
cheB
Definition
Chemotaxis response regulator protein-glutamate methylesterase 1 (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DESAM_22889 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DESAM_22889 (cheB)
Enzymes [BR:dhy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DESAM_22889 (cheB)
Two-component system [BR:dhy02022]
 CheA family
  CheA-CheYBV
   DESAM_22889 (cheB)
Bacterial motility proteins [BR:dhy02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DESAM_22889 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3312828..3313886)
Genome map
AA seq 352 aa AA seqDB search
MIKVLIVDDSASVRELFTEMFKREVDFEVVGCAENGASALQMVADLVPDVATMDVNLPDY
DGFTVTRRIMEECPIPIVIISAVYSASDAELGFRLLDTGALAFHDKPAFNSPDFPDRMAE
IVMSVRLMSEVKVVRRRSRFKRESGLAQPVSRVLKIASEKKLSKVVCIGASTGGPHAIKK
VLMSLPVNFAAPVIIVQHMSGGFTEGMVNWLKGCSGHNIKIAEQGEKLRPGIIYFGPEDY
HLEISKDKEVILLDCPAVNGIRPTVSRLFGSAARNLGKAAVGVLLTGMGRDGADELLEIR
MKGGHTIAQNRETSIVFGMPGEAVKIGAAVSVLPLDKIGAEINSHVSGSLGG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtgattaaggttttgattgtggatgattcagcgtccgtccgtgaattattcaccgaaatg
ttcaagcgagaagttgattttgaggttgtcgggtgtgctgagaatggtgcatctgcactt
caaatggtcgcggatcttgtccctgacgtggccacaatggatgtgaatcttcctgattat
gacggtttcactgttacgcgccgtattatggaggagtgcccgatccctattgtcatcatc
agtgctgtttacagtgcctctgatgccgagctgggattcaggcttcttgatacaggggct
ttggctttccacgataaaccagccttcaacagccctgattttccagaccgtatggctgaa
attgtaatgtctgtccggcttatgtcggaggttaaggtggtccgccgtcgaagccggttt
aaaagagagtcaggtcttgcacagcctgtttccagagtcttgaagattgcgtcggaaaaa
aaattgagtaaagttgtttgtattggagcatctacgggggggccgcatgctattaagaaa
gtgcttatgagtttacctgtcaattttgcagcacctgtaattattgtgcagcatatgtca
ggcgggttcacagaaggtatggtgaactggcttaaaggatgttccggtcataatattaaa
attgccgagcagggtgaaaaacttcggcccggtattatctatttcggtcccgaagactat
catcttgaaatttcaaaagacaaagaagttattttactcgactgtccagctgtgaatggg
attcgtcctactgtttcgagattatttggttctgctgcgcgaaatctgggtaaagctgct
gtcggcgtgcttttgaccggaatgggacgcgacggtgctgatgagttgcttgaaattcgc
atgaaaggcgggcacactatcgcacagaaccgtgaaacatctattgtttttgggatgccg
ggggaggctgtaaagatcggtgctgccgtatctgttttgccacttgataaaatcggggct
gaaattaacagtcatgtcagcgggagcctgggggggtaa

DBGET integrated database retrieval system