KEGG   Desulfovibrio hydrothermalis: DESAM_23078Help
Entry
DESAM_23078       CDS       T02428                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DESAM_23078 (malQ)
Enzymes [BR:dhy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     DESAM_23078 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3497381..3498892
Genome map
AA seq 503 aa AA seqDB search
MKRSSGVLLHFTSLPSRFGVGDLGPAAYDFADFLAEAGQRFWQVLPITPTAPDLCNSPYS
GFSAYAANPLLISPELMVKYGLLEYEEIKEAVLPDRDHADFESAGRVKEKLLRTAFSRKA
NVLLEDPVFNKFIWDNMHWVNDFALFTAVKKHFNGESWTEWPEDIRDRSEDGLRHWGEKL
FREILFVKFCQWIFFRQWGQLKDHLDEIGVELIGDVPIYVTHDSSDVWANRRIFKLDEQG
QSSCVAGVPPDYFSKTGQLWGNPVYNWDVLQSEGFAWWISRMQHNLGLYHWVRLDHFRGF
SAYWEIPVDAETAMEGYWVPAPGHQLFEKLSCEEGCLRIIAEDLGHITHDVTYLKDRFQL
PGMNLLQFSFGEDIGYCGDALHNHRRNSVVYTGTHDNNTNRGWYSDDADEISRRNLLAYL
GFNWVDESKISWELIRLLMSSVGCLCIIQAQDLLNLDGRARMNVPGQANGNWGWKLMPGQ
LTPLIRERLGEMTELFGRTSKID
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttccagcggagtacttttacattttacatcacttccctcccgattcggagtg
ggtgatctaggtccggcggcatatgatttcgccgattttctggccgaagccggacagcgt
ttctggcaggtactccccattactcctacagctccggatctctgcaactcgccatactcc
ggattttccgcctacgccgccaatccgctgctgatcagtcctgagctgatggtaaaatac
ggattgctggaatatgaagaaataaaagaggctgtccttccagatcgtgaccacgctgat
ttcgaatcggccggaagggttaaagaaaaacttctgcgcacagctttcagtcgtaaagca
aatgtcctgctcgaagatcctgttttcaataagtttatctgggataatatgcattgggtg
aatgatttcgcattgtttaccgctgtaaaaaaacattttaacggtgaaagctggacagaa
tggcccgaagatattcgagaccgcagcgaagacggactgcggcattggggcgaaaagctg
ttccgtgaaattttgttcgtaaaattctgccaatggatatttttccgtcaatggggacaa
ctcaaagatcatctagatgaaattggggtggaactgatcggtgatgtacctatatatgta
actcacgacagttctgatgtatgggcaaacaggcgaattttcaaactggacgagcaggga
caatcaagctgcgtggccggcgttccaccagactatttcagcaaaaccggacaactctgg
ggcaaccctgtatacaactgggacgtgctccaaagtgaaggttttgcctggtggatcagc
agaatgcaacacaacctcggcctgtaccattgggtgcggctggaccattttcgcggattc
tcagcctactgggaaatacctgtcgatgctgaaacagctatggaaggatactgggttccc
gcgcccggtcatcagctgtttgaaaaactatcctgcgaggaaggctgtctgcgcatcata
gctgaagatcttggccacattacccatgatgttacttatcttaaagaccgcttccaactg
ccgggtatgaatctgctgcaattctcattcggcgaagatataggttattgcggcgatgct
ctgcataatcacagacgtaattcagtggtatataccggaacccatgacaacaacaccaac
cggggctggtacagcgatgacgctgatgaaataagccgcagaaacctgctcgcctacctc
ggtttcaactgggttgatgaatccaaaatatcatgggagcttatcaggctgcttatgtcc
agtgtaggctgcttatgcataattcaagcacaggacctgcttaatctggacggcagagcg
cgtatgaacgttcccggacaggcaaatggaaactggggctggaagctcatgcccggacag
ctcacccctctcatccgcgagcggctgggagaaatgacagaacttttcggacgcaccagc
aagattgattag

DBGET integrated database retrieval system