KEGG   Desulfovibrio hydrothermalis: DESAM_23109Help
Entry
DESAM_23109       CDS       T02428                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dhy  Desulfovibrio hydrothermalis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dhy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DESAM_23109 (ruvA)
Enzymes [BR:dhy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     DESAM_23109 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3525817..3526428)
Genome map
AA seq 203 aa AA seqDB search
MIAYIHGKLLEATDKSCIILTPGGVGYELFLTITAISTLPEAGADMVFYVHSVVREDAFD
LYGFPCFDDREVFRTLISIDRLGPKKALAILSQFNPKELQDIVFREDVKTLSIVPGIGPK
SARQILWSLKDKMETLKSAVVRSGSCPAEGDRSEFLDALSGLRNLGYADDEVREFLKNIF
DEEPDLDAGGAIRVALKKISQSK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctatattcatggtaaacttctcgaagctacagataagtcatgtattatcctg
acccccggcggggtggggtatgaactctttttgaccattacggccatttcaaccttgccc
gaggcaggggccgatatggttttttatgttcattcagtagtgcgtgaagatgcttttgac
ctttacggctttccctgctttgatgatcgggaagttttccggacccttatttcaattgac
cgcctcgggcctaaaaaagcactggcaatcctttcgcagtttaatcctaaggagttgcag
gatatagtcttccgtgaagatgtgaagacgctttcaattgttccgggtatcgggcctaaa
tcagctcgtcagattctgtggtcgctcaaagataagatggagactcttaaaagtgccgtt
gtccgcagcggttcatgccctgccgagggtgaccgcagtgagtttcttgatgctctttcg
ggtttacgcaatctggggtatgcagatgacgaagtcagggaatttcttaaaaatattttt
gacgaggagcctgatcttgatgccggcggcgcaatcagggtagctctaaagaaaatttct
caaagtaaataa

DBGET integrated database retrieval system