KEGG   Acidovorax ebreus: Dtpsy_0037Help
Entry
Dtpsy_0037        CDS       T00853                                 

Definition
heavy metal translocating p-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
dia  Acidovorax ebreus
Brite
Enzymes [BR:dia01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     Dtpsy_0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
39889..42237
Genome map
AA seq 782 aa AA seqDB search
MTSASLSPAATGDAPAGTLDLGIAGMTCASCVGRVERALRKVPGVQDATVNLATERAHIV
FDAASGGGMEALARRAVRNAGYEPRSVEEQEAGEEGAQSPWAGFTPVAVGLLLSAPLVLP
MLGDLFGLHWMLPAWVQFILATPVQFILGARFYKAGWHAAKALTGNMDLLVAIGTSAGYG
LSLWLWATAESTHGAGHTPHLYFEASAVVITLVLLGKWLEARAKRQTTAAIRALHALRPE
VAHLLGRDGEVDVPIAEVMAGDRLVVRPGERIPVDGTVVEGHTQVDESMLTGEPLPVARS
ADGPEGGALTGGSINGDGRIVMQVTAVGSETVLARIIRLVEDAQAAKAPIQRLVDKVSAV
FVPVVLAIAIVTLLGWLWTGAGVEAALIHAVAVLVIACPCALGLATPAAIMAGTGVAARH
GILIKDAEALETAHRVQTVAFDKTGTLTVGRPRLTAFHVEPGVDEAALLSAVAAVQSGSE
HPLARAVVSAAQERGLPAPAPDGVRAVPGRGTEGEVAARSYLVGSLRWMQELGVDLGPLA
DRAATLQAEGATVSAVAERVAQDPSGARPPEAASAPLGGSEDTIVPSAGAHYVLRALLAF
GDEPKPGAREALAHLRTQGVRCVMISGDNRGAAEAMARRLGLQPEAGEVMAEVLPGDKAA
AVNALKAQGHVVAMVGDGVNDAPALAAADVGMAMGNGTDVAMHAAGITLMRGDPQLVAAA
LDISRRTVAKIRQNLFWAFAYNVAGIPLAALGYLSPVVAGAAMALSSVSVMTNALLLKRW
RG
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgcttccctttcccctgccgcaacgggcgacgcccccgcgggcacgctggac
ctgggcattgccggcatgacctgcgcgagctgcgtgggccgggtggaacgtgcgctgcgc
aaggtgccgggcgtgcaggacgccacggtgaacctggcgaccgagcgcgcgcacatcgtg
ttcgacgccgccagcggcggaggcatggaggcgctggcacgccgcgccgtgcgcaatgcc
ggctacgagccacgcagcgtggaggagcaggaagcgggtgaggagggcgcgcagtcgccc
tgggcaggcttcacgccggtggccgtggggttgctgctgtcggcgccgctggtgctgccc
atgctgggcgatctgttcggcttgcactggatgctgccggcgtgggtgcagttcatcctg
gccacaccggtgcagttcattctgggcgcgcgcttttacaaggcgggctggcatgccgcc
aaggcgctcacgggcaacatggacctgctggtggccatcggcaccagcgcgggctacggc
ctgtcgctgtggctgtgggccacggccgaatccacccatggcgcagggcacacgccgcac
ctgtacttcgaggcatcggccgtggtgatcacgctggtgctgctgggcaagtggctggaa
gcgcgcgccaagcgccagaccacggccgccatccgcgcgctgcacgcgctgcgccccgag
gtggcccacctgctgggccgggacggcgaggtggacgtgccgattgccgaggtgatggcc
ggtgaccggctggtggtgcgcccgggcgagcgcatccccgtggacggcacggtggtggaa
gggcacacgcaggtggacgaatccatgctgaccggcgagccgctgcccgtggcgcgcagc
gccgatggcccggaaggcggggcgctcaccggcggctcgatcaatggcgatgggcgcatc
gtgatgcaggtgacggccgtgggaagcgagacggtgctcgcgcgcatcatccgcctggtg
gaggatgcgcaggcggccaaggcgcccatccagcggctggtggacaaggtgtcggcggtc
ttcgtgccggtggtgctggcgattgccatcgtcacgctgctgggctggctgtggacgggc
gcgggcgtggaggccgcgctgatccatgcagtggcggtgctggtcatcgcttgcccctgt
gcgctgggactggccacgccggcggccatcatggcgggcaccggcgtggcggccaggcac
ggcatcctcatcaaggatgccgaggcgctggaaaccgcccaccgcgtgcagaccgtggcc
tttgacaagaccggtacgctgaccgtgggccgcccgcgcctgacggcgtttcacgtggaa
ccaggggtggatgaggcggcactgctgtcggctgtggccgcggtgcagagcggcagtgag
cacccgctcgcacgcgccgtggtgagcgccgcccaggagcgtggcctgcctgctcctgcg
cccgacggagtgcgcgccgtgcccggccgcggcaccgagggcgaggtggcagcacggagt
tacctggtcggcagcctgcgctggatgcaggagctgggcgtggacctgggcccgctggcc
gatcgtgcggccacgctgcaggccgaaggcgccaccgtgtccgcggtggccgagcgggtc
gcgcaggatccgagcggcgcacggccgcccgaagccgcgagcgctcccttggggggcagc
gaggacacgatagtgccgagcgcgggggcgcactatgtcttgcgcgcgctgctggccttt
ggcgacgagcccaagcccggcgcacgcgaggcactggcgcacctgcgcacccagggcgtg
cgctgcgtgatgatctctggcgacaaccgcggcgcggccgaggccatggcccgccgcctg
ggcctgcagccggaggccggcgaagtgatggccgaggtgctgcccggcgacaaggcggcg
gcggtgaacgcgctgaaggcgcaaggccatgtcgtggccatggtgggcgacggcgtgaac
gacgcgcccgcgctggccgcggccgatgtggggatggccatgggcaacggtaccgacgtg
gccatgcacgcggcgggcatcacgttgatgcgcggcgacccgcagctggtggcggcggcg
ctggacatctcgcggcgcacggtggccaagatccgccagaacctgttttgggcctttgca
tacaacgtggccggtattccgctggcggcgctgggctacctgagtcccgtggtcgcgggg
gccgcgatggcgctgagttcggtcagcgtgatgacgaatgcgttgttgctcaagcgttgg
cgggggtga

DBGET integrated database retrieval system