KEGG   Acidovorax ebreus: Dtpsy_0191Help
Entry
Dtpsy_0191        CDS       T00853                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dia  Acidovorax ebreus
Pathway
dia00480  Glutathione metabolism
dia00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dtpsy_0191
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dtpsy_0191
Enzymes [BR:dia01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dtpsy_0191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ACM31676
UniProt: B9MAM9
Position
complement(213405..213890)
Genome map
AA seq 161 aa AA seqDB search
MTTAYDFDATRIDGAPQPLSDFRGQVLLIVNTASACGFTPQFTGLQALHERYGPRGLVVL
GFPCNQFGHQDPGSNDAIAGFCQRNYGVQFPMMSKIDVNGSDAHPLYRWLTGEAPGVLGT
KAIKWNFTKFLVGRDGQVIRRYAPQEAPEKLTVDIEAALAA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgcgtatgacttcgacgcgacacgcatcgacggcgcaccccagccactgagc
gacttccgcggtcaggtgctgctcatcgtcaacaccgccagcgcctgcggcttcacgccg
cagttcaccgggctgcaggcgctgcatgaacgctacgggccgcgcgggctggtagtgctc
ggctttccgtgcaaccagttcggccaccaggacccgggcagcaacgacgccatcgcgggc
ttttgccagcgcaactatggcgtgcagtttcccatgatgtccaagatcgacgtcaacggc
agcgacgcgcacccgctgtaccgctggctcaccggcgaagcgcccggcgtgctgggcacc
aaggcgatcaagtggaacttcaccaagttcctggtcggccgggacggccaggtgatccgc
cgctacgcgccgcaggaggctcccgagaagctcacggtcgacatcgaggcagcgctggcg
gcctga

DBGET integrated database retrieval system