KEGG   Acidovorax ebreus: Dtpsy_0327Help
Entry
Dtpsy_0327        CDS       T00853                                 

Definition
malate synthase g (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dia  Acidovorax ebreus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtpsy_0327
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dtpsy_0327
   00630 Glyoxylate and dicarboxylate metabolism
    Dtpsy_0327
Enzymes [BR:dia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dtpsy_0327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(336235..338436)
Genome map
AA seq 733 aa AA seqDB search
MTARTHVHGLQVANELHAFINEQVLPGTGVEPAAFWKGFDALVADLAPKNAALLAERDRL
QKELDTWHKANPGPIQDMAGYRAFLSQIGYLVEPPKGAQATTTNVDAELAIQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDVIGEEGGAEKGKGYNPVRGAKVIAFARDFLDQAA
PLASGSHKDATAYRVEGGTLAVTLQGGATTGLKNAAQFVGYQGNAAEPSSVLLVNNGLHI
DIRVDRNTPIGKGDAAGVADVVVEAALSTILDLEDSVAAVDAEDKVLGYSNWLGILKGTL
TDTFDKGGKQVTRGLNPDREYNGADGKPVKLHGRSLMFVRNVGHLMTNPAILWGAEGKEI
PEGILDAMVTTAIAIHDLKGGAGGIRNSRTGSVYIVKPKMHGPAEVAFANELFGRVEQVL
GLPANTVKLGIMDEERRTSVNLKACIAAAPARVAFINTGFLDRTGDEMHTAMQAGPMIRK
GDMKSSAWIQAYERNNVLVGLSMGLSGRAQIGKGMWAAPDLMKAMLEQKIAHPKAGANTA
WVPNPTGATLHTLHYHQVNVAAVQAELLKVDADAERDNLLTGLLTVPVSSNPHWSETEKQ
QELDNNIQGILGYVVRWIDQGVGCSKVPDINDIGLMEDRATLRISSQHVANWLLHGVVTE
GQVRATFERMAAKVDQQNGGDPLYQRMHGRFAESMAYQAACDLVFKGVEQPSGYTEPLLH
AWRQKVKAAQKKA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgtacccacgtccacggcctgcaggtggccaacgaactgcacgccttcatc
aacgagcaggtgctgccgggcaccggcgtcgagccggccgccttctggaagggcttcgat
gccctcgtggccgacctggcgcccaagaacgcggccctgctggccgaacgcgaccgcctg
caaaaagaactggacacctggcacaaggccaacccgggccccatccaggacatggcaggc
taccgcgccttcctgagccagatcggctacctggtcgagccccccaagggcgcgcaggcc
accaccactaacgtggatgccgagctggccatccaggccggcccacagctggtggtgccc
atcctgaacgcacgctacgccctgaacgccgccaacgcgcgctggggctcgctgtatgac
gcgctgtacggcaccgacgtgatcggcgaagaaggcggcgccgagaagggcaagggctac
aaccccgtgcgcggcgccaaggtcatcgcattcgcacgcgactttctggaccaggcggcc
ccgctggccagcggctcgcacaaggacgccacggcctacagggtagagggcggcacgctg
gccgtcacgctccagggcggtgccaccaccggcctgaagaacgcggcccagttcgtgggc
taccagggcaatgcggccgagccatcgtccgtactgctggtgaacaacggcctgcacatc
gacatccgcgtggaccgcaacacccccatcggcaagggcgacgccgccggcgtggccgac
gtggtggtggaagctgcgctgtccaccatcctggacctggaagactccgtggccgccgtg
gacgccgaggacaaggtgctgggctacagcaactggctgggcatcctcaagggcacgctg
accgacaccttcgacaagggcggcaagcaggtcacgcgcggcctgaaccccgaccgcgaa
tacaacggcgccgacggcaagcccgtgaagctgcacggccgctcgctgatgttcgtgcgc
aacgtgggccatctgatgaccaaccccgccatcctgtggggtgccgagggcaaggagatc
cccgagggcatcctggacgccatggtcaccacggccatcgccatccacgacctcaagggc
ggcgcgggcggcatccgcaacagccgcacgggcagcgtctacatcgtcaagcccaagatg
cacggccctgccgaagtggcgtttgccaacgagctgttcggccgcgtggagcaggtgctg
ggcctgcccgccaacaccgtgaagctgggcatcatggacgaagagcgccgcaccagcgtg
aacctgaaggcctgcattgccgccgctccggcgcgcgtggccttcatcaacaccggcttc
ctggaccgcacgggcgacgagatgcacaccgccatgcaggccggccccatgatccgcaag
ggcgacatgaagagcagcgcctggatccaggcctacgagcgcaacaacgtgctggtgggc
ctgtccatgggcctgtccggccgcgcgcagatcggcaagggcatgtgggccgcacccgac
ctgatgaaggccatgctggagcagaagatcgcccatcccaaggccggcgccaacaccgcc
tgggtgcccaaccccacgggcgccacgctgcacacgctgcactaccaccaggtcaacgtg
gccgccgtgcaggccgagctgctgaaggtggacgccgacgccgagcgcgacaacctgctg
accggcctgctcaccgtgcccgtgagcagcaacccgcactggagcgagaccgaaaagcag
caggagctggacaacaacatccagggcatcctgggctacgtggtgcgctggatcgaccag
ggcgtgggctgctccaaggtgccggacatcaacgacatcggcttgatggaagaccgcgcc
acgctgcgcatctccagccagcacgtggccaactggctgctgcacggcgtggtgaccgaa
ggccaggtgcgcgccacgttcgagcgcatggccgccaaggtggaccagcaaaacggcggc
gacccgctgtaccagcgcatgcacggccgctttgccgagtccatggcctaccaggccgcc
tgcgacctggtgttcaagggcgtagagcagcccagcggctacaccgagccgctgctgcac
gcctggcgccagaaggtgaaggccgcgcagaagaaggcttga

DBGET integrated database retrieval system