KEGG   Acidovorax ebreus: Dtpsy_0361Help
Entry
Dtpsy_0361        CDS       T00853                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dia  Acidovorax ebreus
Pathway
dia00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01130  Biosynthesis of antibiotics
dia01230  Biosynthesis of amino acids
Module
dia_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dtpsy_0361
Enzymes [BR:dia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dtpsy_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACM31845
UniProt: B9MBS5
Position
370241..371041
Genome map
AA seq 266 aa AA seqDB search
MSDILKKICDVKVEEVAAAQKRVSFTDMRRDAESRVLTRDFVGALRAKIDQGQAGVIAEI
KKASPSKGVIREDFIPADIAQSYAEGDGKVSAACLSVLTDRQFFQGQPDYLKQARASCPL
PVLRKDFMIDPYQIYESRAMGADCVLLIAACLEDGLMAEMEQFARSLDMAVLVEVHDGAE
LERALRLQTPLVGINNRNLRTFEVSLQTTLDLKKEVPADRLLVAESGILAPVDVHTLRDA
GVNAFLVGEAFMRAPDPGRALAQLFA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctgaagaaaatctgcgacgtgaaggtcgaggaagtggccgccgcgcaa
aagcgcgtgtccttcaccgacatgcgccgcgacgccgagagccgcgtgctcacgcgcgac
ttcgtgggcgcgctgcgcgccaagatcgaccagggccaggccggcgtgatcgccgaaatc
aagaaggccagccccagcaagggcgtgatccgcgaggatttcatcccggccgacattgcg
caaagctacgccgagggcgacggcaaggtcagcgcggcctgcctgtcggtgctgaccgac
cgccagttctttcaaggccagcccgattacctgaagcaggcacgcgccagttgcccgctg
ccggtgctgcgcaaggacttcatgatcgatccgtaccagatctacgagtcgcgcgccatg
ggcgccgactgtgtgctgctgatcgccgcctgcctcgaggatggcctgatggccgagatg
gagcagttcgcccgcagcctggacatggccgtgctggtggaggtgcacgacggcgccgag
ctggagcgcgcgctgcgcctgcagacgccgctcgtgggcatcaacaaccgcaacctgcgc
accttcgaggtcagcctgcagaccacgctggacctgaagaaggaagtgcctgccgaccgc
ctgctggtggccgagtccggcatccttgcgccggtggatgtgcacacgctgcgcgatgcc
ggcgtgaatgcgttcctggtgggcgaggccttcatgcgcgcgcccgacccggggcgggcg
ctggcccagctgttcgcctga

DBGET integrated database retrieval system