KEGG   Acidovorax ebreus: Dtpsy_0373Help
Entry
Dtpsy_0373        CDS       T00853                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dia  Acidovorax ebreus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dtpsy_0373
Enzymes [BR:dia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dtpsy_0373
Exosome [BR:dia04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dtpsy_0373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(385521..387017)
Genome map
AA seq 498 aa AA seqDB search
MTYLLALDQGTSSSRSIVFDERGRIVAQAQRELPQIYPRPGWVEHDPREIWRTQLATAQD
ALREARITAQDVRALGITNQRETTVLWNRRTGQPVHHAIVWQDRRAEPACAQLREQGHAA
AIQAKTGLLIDAYFSGTKLQWLLDHVPGARDAAEAGELAFGTVDSWLIWQLTGGTRHVTD
VSNASRTMLFNVHTNQWDDELLQLLRIPRALMPEVLPSASDFGATDAALLGGPIAIGGVA
GDQQSALFGQACFTAGMAKNTYGTGCFMLMHTGSRFQKSENGLLTTSAAQASRSPEYAME
GSVFVGGAVVQWLRDGLRAISASSEVQALAESVPDSGGVMMVPAFTGLGAPYWKPDARGT
ITGLTRGTTIAHIARAALESIAYQSAALLAAMSRDAVAAGGAPVSELRVDGGACVNDLLM
QFQADLLGIPVVRPAVVETTALGAAYLAGLASGVYASTDELSALWQAERRFTPTLPRSQA
EALMARWEHAVAQAVLPG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacctacctgctcgcactcgaccaaggcacctccagctcccgcagcatcgtgttcgac
gaacgtggccgcatcgtggcccaggcgcagcgcgagctgccgcagatctatccccgcccc
ggctgggtggaacatgacccgcgcgagatctggcgcacgcagctcgccaccgcgcaggac
gcgctgcgcgaggcgcgcatcaccgcgcaggacgtgcgcgccctgggcatcaccaaccag
cgcgagaccaccgtgctgtggaaccgccgcaccggccagcccgtgcaccacgccatcgtc
tggcaggaccggcgcgccgagcccgcctgcgcgcaactgcgcgaacagggccatgccgcc
gccatccaggccaagacgggcctgctgatcgacgcctatttctccggcaccaagctgcaa
tggctgctggaccatgtgcccggcgcgcgcgacgcggccgaggccggcgagctggccttc
ggcaccgtggacagctggctcatctggcagctcaccggcggcacgcgccatgtcaccgac
gtgagcaacgccagccgcaccatgctgttcaacgtgcacaccaaccagtgggacgatgag
ctgctgcagcttttgcgcatcccgcgcgcgctgatgcccgaagtgctgccatcggccagc
gacttcggcgccaccgacgcggcgctgctgggcggcccgatcgccatcggcggcgtggca
ggcgaccagcaaagcgcgctcttcggccaggcgtgcttcaccgccggcatggccaagaac
acctacggcacgggctgtttcatgctcatgcacaccggcagccgctttcagaaaagcgag
aacggcctgcttaccaccagcgcggcgcaagccagccgatcgcccgagtacgccatggaa
ggcagcgtgttcgtgggcggcgccgtggtgcagtggctgcgcgacgggctgcgcgccatc
tcggccagctccgaggtgcaggcgctggccgaaagcgtgcccgactcgggcggcgtgatg
atggtgcctgccttcaccggcctgggcgcgccctactggaagcccgacgcgcgcggcacc
atcaccggcctcacgcgcggcaccaccatcgcgcacatcgcgcgcgccgcgctcgaatcc
attgcctaccagagcgccgcgctgctggccgccatgagccgcgacgccgtggccgcaggc
ggcgccccggtgagcgagctgcgcgtggacggcggcgcctgcgtgaacgacctgctgatg
cagttccaggccgacctgctgggcattcccgtggtgcgccccgccgtggtggagaccacc
gccctgggcgccgcctacctggcgggcctggcgagcggcgtgtatgccagcaccgacgag
ctgtctgccctgtggcaggccgagcggcgcttcacccccaccctgccgcgcagccaggcc
gaggcgttgatggcgcgttgggaacacgccgtcgcgcaggccgtgctacccggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system