KEGG   Acidovorax ebreus: Dtpsy_0448Help
Entry
Dtpsy_0448        CDS       T00853                                 

Definition
DNA-3-methyladenine glycosylase i (EC:3.2.2.20)
Orthology
K01246  
DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
dia  Acidovorax ebreus
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:dia00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dtpsy_0448
Enzymes [BR:dia01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     Dtpsy_0448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
460928..461626
Genome map
AA seq 232 aa AA seqDB search
MRPNPHNAPMLETTEPSSPDEASGLFTDEGGHARCFWCGASPLYQHYHDHEWGFPVTDER
RLFEKLCLEGFQAGLSWITILNKREAFRAALAQFEAEPLADFGAAEVDQLMGNAGIVRHR
GKIESAINNARRVLELRREFGSLAHYVWRYAPLAAQQRPERMTLPAVRAMTTSAASVALS
KDLKKRGFSFVGPTTMYAFMQAMGLVNDHLEGCGARAAAEAARAAFTPPAAG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcgacccaacccccacaatgcccccatgctcgaaaccaccgaaccctcctccccagac
gaagccagtggcctgttcaccgacgagggcggccatgcgcgctgcttctggtgcggcgcc
agcccgctgtaccagcactaccacgaccacgaatggggcttcccggtgacggacgagcgc
cgcctgttcgagaagctctgcctggaggggttccaggccggcttgtcgtggatcaccatc
ctgaacaagcgcgaggccttccgcgcggcgctggcgcagttcgaggccgagccgctggcg
gacttcggcgccgccgaggtggaccaactgatgggcaacgccggtatcgtgcgccaccgc
ggcaagatcgagtcggccatcaacaatgcgcgccgcgtgctggagctgcgccgcgagttc
gggtcgctggcgcactatgtgtggcgctatgcgcccctggccgcgcagcagcggcccgag
cgcatgacgctgcctgcggtgcgtgcgatgaccacctcggcggcgtcggtggcgctgtcc
aaggatttgaagaagcgtgggttcagcttcgtgggtccaaccaccatgtatgccttcatg
caggccatggggctggtcaacgaccacctggagggctgcggcgcacgcgctgcggcagag
gccgcgcgcgccgcgttcacaccccccgctgcgggctga

DBGET integrated database retrieval system