KEGG   Acidovorax ebreus: Dtpsy_0493Help
Entry
Dtpsy_0493        CDS       T00853                                 

Gene name
ruvA
Definition
holliday junction DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dia  Acidovorax ebreus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dia00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dtpsy_0493 (ruvA)
Enzymes [BR:dia01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Dtpsy_0493 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
508750..509322
Genome map
AA seq 190 aa AA seqDB search
MIGKLTGTLLEKNPPEVLVDCHGVGYEVLVSMSTFYNLPAVGERVSLLTQFIVREDAQLL
YGFGTAQERQAFRELIKISGVGPRTALSILSGMGVADLAQAVSLQEAGRLVKVPGIGKKT
AERLLLELKGKLGADVGVRAHAANDNQADILQALLALGYNDKEAAAALKALPADVGVSEG
IKLALKSLSK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgataggcaaattgaccggcacgctgctggaaaagaacccccccgaggtgctggtggac
tgccacggcgtgggctacgaggtgctggtcagcatgagcaccttctacaacctgcccgcc
gtgggtgagcgggtgagcctgctcacgcagttcatcgtgcgcgaggatgcgcagctgctg
tacggctttggtacggcgcaggagcgccaggcgtttcgcgaactcatcaagatcagcggc
gtggggccgcgcacagcgctgtccatcctctcgggcatgggcgtggcggacctggcgcag
gccgtttcgctgcaggaagcagggcgcctggtcaaagtgccgggtatcggcaagaaaacc
gccgagcggctgctgctggagctgaaaggcaagctgggcgcggacgtcggcgtgcgcgcg
catgcggccaacgacaaccaggccgacatcctgcaggcgctgctggccctgggctataac
gacaaggaggccgccgctgcgctcaaggcgctgccggcggatgtgggagtgagcgagggg
atcaagctggcgctgaaatcgctatccaaatag

DBGET integrated database retrieval system