KEGG   Acidovorax ebreus: Dtpsy_0628Help
Entry
Dtpsy_0628        CDS       T00853                                 

Definition
cheb methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dia  Acidovorax ebreus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dia00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dtpsy_0628
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Dtpsy_0628
Enzymes [BR:dia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Dtpsy_0628
Two-component system [BR:dia02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Dtpsy_0628
Bacterial motility proteins [BR:dia02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Dtpsy_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
649440..650039
Genome map
AA seq 199 aa AA seqDB search
MRQAALPRARLDAIAIGGSAGSIEALGVVLPALPAGFHAALLVVLHLPRERPSLLCNIFR
QRCALPVREAQDKEPVEPGTVYFAPPDYHLLVDSGPRLSLSVDAPLNFSRPSIDVLFESA
ADEYGPRLMAVLLSGANSDGARGLRAVQAAGGATVVQSPDSASSMAMPQAALALIQPDQV
LPPARIAALLTTLHKEGLS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaggcggctttgccacgcgcgcgcctggacgccatcgccattggcgggtcggcc
ggcagcatcgaagcgctgggtgtggtgcttcccgcgctgcctgcgggtttccatgcggcc
ctgctggtcgtgctgcacctgccgcgcgagcggcccagcctgctgtgcaacatcttccgc
cagcgctgcgccctgccggtgcgcgaggcccaggacaaggagcccgtggagccgggcacg
gtgtatttcgcgccgcctgactatcatttgctggtggattcggggccgaggctgtccctg
tccgtggatgcaccgctgaatttctcgcgcccgtcgatcgacgtgttgttcgaatccgcc
gccgatgaatacgggccgcggctcatggccgtgctcctgtcgggcgcgaacagtgacgga
gcgcgtggcttgcgcgcagtgcaggccgctggcggcgccacggtggtgcagtcgcccgac
agcgcttcgtccatggccatgccgcaggcggcgctggccctgatccaacccgatcaggtg
cttcccccggcacgcatcgccgcgctgttgaccaccttgcataaggagggactttcgtga

DBGET integrated database retrieval system