KEGG   Acidovorax ebreus: Dtpsy_0725Help
Entry
Dtpsy_0725        CDS       T00853                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
dia  Acidovorax ebreus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dia00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dia00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
755043..756365
Genome map
AA seq 440 aa AA seqDB search
MDKLLIRGGRPLVGEVPISGAKNAALPELCAALLTADPVTLHNVPRLQDVATMLRLIRNM
GVQVDRIANPDCSVADAAGIVRLDAGALSTPEAPYDLVKTMRASVLALGPLLARFGEATV
SLPGGCAIGSRPVDQHIKGLQAMGAQIVVEHGYMIARLPQGCTRLRGARITTDMVTVTGT
ENLLMAATLAEGETVLENAAQEPEVADLAEMLIKMGARIEGHGTSRIRIQGVERLHGCEH
AVVADRIEAGTFLCAVAATGGDALLRHGRADHLDAVIDKLRDAGVQVAPEEGGIRVRSPG
AAQLKAQGFRTTEYPGFPTDMQAQFMALNVVAQGTATVAETIFENRFMHVNELLRLGAKI
QTTDGRVAVIEGLGGAAPAGARLSGATVMATDLRASASLVIAGLVADGETLVDRIYHLDR
GYDCMEAKLRGLGADIERIQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactcctgattcgcggtggccgccccctggtgggcgaggtgccgatttccggc
gccaagaacgccgcgctgcccgagctgtgcgccgcgctgctcacggccgacccggtcacc
ctgcacaacgtgccgcgcctgcaggacgtagccaccatgctgcggctcatccggaacatg
ggcgtgcaggtggaccgcatcgctaaccccgactgctccgtggccgatgcggccggcata
gtgcgcctggacgcgggcgccctgtccacgcctgaggcgccctacgatctggtcaagacc
atgcgcgcctcggtactggcgctggggccgctgctggcgcgtttcggcgaggccacggtg
tcgctgccgggcggctgcgccatcggatcgcgcccggtggatcagcacatcaaggggctg
caggccatgggcgcgcagatcgtggtcgagcacggctacatgatcgccaggctgccgcag
gggtgcacgcgactcaggggggcgcgcatcaccaccgacatggtcacggtgaccggcacc
gagaatctgctcatggccgccacgctggctgagggggagaccgtgctggagaacgccgcg
caggaacccgaggtggcggacctggccgagatgctcatcaagatgggcgcgcgtatcgag
ggccatggcaccagccgcatccgcatccagggggtcgagcggctgcacggctgcgagcac
gccgtcgtggccgaccgcatcgaggccggcaccttcctgtgcgccgtggccgccacgggc
ggcgacgcgctgctgcgccacgggcgtgccgaccacctggacgccgtgatcgacaaactg
cgcgacgcgggcgtgcaggtggcgccggaagagggtggcatccgcgtgcgcagccctggc
gcggcgcagctcaaggcgcagggctttcgcaccactgagtacccgggctttcccaccgac
atgcaggcgcagttcatggcgctgaacgtggtggcccagggcaccgccacggtggccgag
acgatcttcgagaaccgtttcatgcacgtcaacgagttgttgcgccttggcgcgaaaatc
cagaccacggatggccgcgtagcggtgatcgaggggctgggcggcgcggcgcctgcgggg
gcgcggctgtcgggcgccaccgtcatggccaccgacctgcgcgcctcggccagcctggtg
atcgccggcttggtggccgacggggaaacgctggtggaccgcatctaccatctggaccgc
ggctacgactgcatggaagccaaactgcgcggcctgggggccgacatcgagagaattcaa
tga

DBGET integrated database retrieval system