KEGG   Acidovorax ebreus: Dtpsy_0862Help
Entry
Dtpsy_0862        CDS       T00853                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dia  Acidovorax ebreus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dtpsy_0862
Enzymes [BR:dia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dtpsy_0862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
886766..887386
Genome map
AA seq 206 aa AA seqDB search
MDYPGNLFVVSAPSGAGKSSLVKALLELDSHVQPSVSHTTRAPRGQEKHGREYFFASEQE
FDAMVAANGFVEWANVHGRRYGTSRKVIEERVAQGADVVLEIDFQGALQIKQAFANAVLV
FVLPPSWDELRARLERRGEDAPDVIDLRLENAAEEMAQASKFDFVIINEVFERALFDLKT
IVHAQRLKYAAQRRARAETFESLNIP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggactatcccggaaatttgtttgtagtctctgcccccagcggggcgggtaaatccagc
ttggtcaaggccctgctggagctggactcgcatgtgcagccctccgtgtcgcacacgacc
cgcgcgccgcgcgggcaggaaaagcacggccgcgagtacttcttcgcttccgagcaggag
ttcgacgcgatggtggcggctaacggcttcgtcgagtgggcgaacgtccatggacgccgt
tatggaacctcccgcaaggtgatcgaggagcgcgtggcccagggggcggacgtggtcttg
gaaatcgactttcagggcgcgctgcagatcaagcaggccttcgcgaacgccgtgctggtc
tttgtgctgccgcccagctgggacgagttgcgcgcccggctggaacgccggggcgaagat
gcgcccgacgtgattgacctacgcctggagaacgcggcagaggaaatggcgcaggccagc
aaattcgacttcgttataatcaatgaggtctttgagcgagcgcttttcgacctgaaaacc
atcgttcatgcccagcgtctcaagtacgccgcccagcgccgcgcccgggccgaaaccttc
gagtcgctcaatattccctga

DBGET integrated database retrieval system