KEGG   Acidovorax ebreus: Dtpsy_0870Help
Entry
Dtpsy_0870        CDS       T00853                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dia  Acidovorax ebreus
Pathway
dia00010  Glycolysis / Gluconeogenesis
dia00051  Fructose and mannose metabolism
dia00562  Inositol phosphate metabolism
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01120  Microbial metabolism in diverse environments
dia01130  Biosynthesis of antibiotics
dia01200  Carbon metabolism
dia01230  Biosynthesis of amino acids
Module
dia_M00002  Glycolysis, core module involving three-carbon compounds
dia_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtpsy_0870
   00051 Fructose and mannose metabolism
    Dtpsy_0870
   00562 Inositol phosphate metabolism
    Dtpsy_0870
Enzymes [BR:dia01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dtpsy_0870
Exosome [BR:dia04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dtpsy_0870
  Exosomal proteins of bladder cancer cells
   Dtpsy_0870
  Exosomal proteins of melanoma cells
   Dtpsy_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACM32348
UniProt: B9MEL2
Position
895134..895886
Genome map
AA seq 250 aa AA seqDB search
MTQKKKLIAGNWKMNGSLQANAVLLQALRDGLGAPGCGVAVAVPAPYLAQVQALVAGSEI
ALAAQDVSQHETGAFTGEVSVSMLRDFGARYALVGHSERRQYHGETDAVVAAKAQRALSG
GVTPIVCVGETLAEREAGQTETVVKRQLAAVIHAVGHCVSEIVVAYEPVWAIGTGRTATP
EQAQQVHAVLRAQLAAATESADRVLILYGGSMNAANAAELLAQPDIDGGLVGGASLKAAD
FLKIIAAAHS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaaaaagaaactcattgccggcaactggaagatgaacggtagcctgcaggcg
aatgcggtgctgctgcaggcattgcgcgatggcttgggcgcgcccggctgtggcgtggcg
gtggccgtgccagcgccctacctggcgcaggtgcaggccttggtcgcgggcagcgaaatc
gctctggctgcccaggatgtatcgcaacatgaaacgggcgcgttcaccggcgaggtctct
gtgagtatgttgcgcgactttggtgcacgctacgcgcttgtggggcactccgagcgtcgc
caataccatggcgaaaccgatgccgtggtcgcggccaaggcccagcgggcgctctcgggc
ggcgtcacgccgatcgtatgcgtgggagaaactctggccgagcgcgaggcgggccagacc
gagaccgtcgtcaagcgccaactggcggctgtaatccatgccgtggggcactgcgtgagc
gagatcgtggtggcctacgagcctgtctgggccatcggcaccggccgcacggcaacgcca
gagcaggcgcagcaggtgcatgcggtgctgcgcgctcagctcgccgccgcgaccgagagc
gcggaccgcgtgctcatcctgtatggcggcagcatgaatgctgccaacgcagccgaactg
ctggcgcagccggatatcgatgggggcctggtgggcggtgcgtcgctcaaggccgcggat
ttcttgaaaattatcgctgcagcgcatagctga

DBGET integrated database retrieval system