KEGG   Acidovorax ebreus: Dtpsy_0870Help
Entry
Dtpsy_0870        CDS       T00853                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dia  Acidovorax ebreus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtpsy_0870 (tpiA)
   01230 Biosynthesis of amino acids
    Dtpsy_0870 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtpsy_0870 (tpiA)
   00051 Fructose and mannose metabolism
    Dtpsy_0870 (tpiA)
   00562 Inositol phosphate metabolism
    Dtpsy_0870 (tpiA)
Enzymes [BR:dia01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dtpsy_0870 (tpiA)
Exosome [BR:dia04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dtpsy_0870 (tpiA)
  Exosomal proteins of bladder cancer cells
   Dtpsy_0870 (tpiA)
  Exosomal proteins of melanoma cells
   Dtpsy_0870 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
895134..895886
Genome map
AA seq 250 aa AA seqDB search
MTQKKKLIAGNWKMNGSLQANAVLLQALRDGLGAPGCGVAVAVPAPYLAQVQALVAGSEI
ALAAQDVSQHETGAFTGEVSVSMLRDFGARYALVGHSERRQYHGETDAVVAAKAQRALSG
GVTPIVCVGETLAEREAGQTETVVKRQLAAVIHAVGHCVSEIVVAYEPVWAIGTGRTATP
EQAQQVHAVLRAQLAAATESADRVLILYGGSMNAANAAELLAQPDIDGGLVGGASLKAAD
FLKIIAAAHS
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaaaaagaaactcattgccggcaactggaagatgaacggtagcctgcaggcg
aatgcggtgctgctgcaggcattgcgcgatggcttgggcgcgcccggctgtggcgtggcg
gtggccgtgccagcgccctacctggcgcaggtgcaggccttggtcgcgggcagcgaaatc
gctctggctgcccaggatgtatcgcaacatgaaacgggcgcgttcaccggcgaggtctct
gtgagtatgttgcgcgactttggtgcacgctacgcgcttgtggggcactccgagcgtcgc
caataccatggcgaaaccgatgccgtggtcgcggccaaggcccagcgggcgctctcgggc
ggcgtcacgccgatcgtatgcgtgggagaaactctggccgagcgcgaggcgggccagacc
gagaccgtcgtcaagcgccaactggcggctgtaatccatgccgtggggcactgcgtgagc
gagatcgtggtggcctacgagcctgtctgggccatcggcaccggccgcacggcaacgcca
gagcaggcgcagcaggtgcatgcggtgctgcgcgctcagctcgccgccgcgaccgagagc
gcggaccgcgtgctcatcctgtatggcggcagcatgaatgctgccaacgcagccgaactg
ctggcgcagccggatatcgatgggggcctggtgggcggtgcgtcgctcaaggccgcggat
ttcttgaaaattatcgctgcagcgcatagctga

DBGET integrated database retrieval system