KEGG   Acidovorax ebreus: Dtpsy_0993Help
Entry
Dtpsy_0993        CDS       T00853                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
dia  Acidovorax ebreus
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dia00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:dia00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1033765..1035231
Genome map
AA seq 488 aa AA seqDB search
MNAASTWISRNVDRLRSADSKAASKNKDKDGASAASPKPAAERSTHERLQATLRRSGEAL
SPRVLRRLLTDLQEVVAPRVSEIEGGRRAQAIAAWYAEATPEERRDLWLLMCEQFAPDAT
RFKSAQQRYEAAAGTDDAPQAEAHLRRAMVSPRTRLLQRFAVFPAGMRFLVDLRAELLPL
LKSDKRLLPLDAELEQLFSTWFDVAFLELRRLSWDSPASLIEKLIKYEAVHDIRSWADLK
NRLDSDRRCYGFFHPRLPNEPLIFVEVALVNEISSSITPLLDEAAEAADIQRATTAIFYS
ISSTQTGLRGVSFGDSLIKHVAETLTQEFPRLRTFATLSPIPGFRSWLSKNCAAQLEQLD
EKRLAELGRAVGFEPPQAAHVLAAADKALELPPKSPVRQLLMQCAARYLGRELHDGKPVD
PVARFHLGNGARVERLNWAGDPSAKGLKQSFGLMVNYLYDLKRIDKHHGLLAQGRVPVSG
DIDSLCRD
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgcctccacctggatctcgcgcaacgtggaccgcctgcggtccgcagacagc
aaagccgccagcaagaacaaggacaaggacggcgcaagcgccgcgtcgcccaagcctgcg
gccgaacgctccacgcacgagcgcctgcaggccacgctgcgcaggagcggcgaggcgctg
tcgccccgcgtgctgcgccggttgctgaccgacctgcaggaagtggtggccccgcgcgtg
agcgagatcgaaggcgggcgccgcgcgcaggccattgccgcgtggtacgccgaggccacg
cccgaagagcggcgcgacctgtggttgctgatgtgcgagcagttcgcgcccgatgccacg
cgtttcaaatcggcccagcagcgctacgaggccgccgccggcaccgacgatgcgccccag
gccgaagcccacctgcgccgcgccatggtgtcgccgcgtacacggctgctgcagcgcttt
gcggtgtttccggcaggcatgcgcttcctcgtggacttgcgcgccgagctgctgcccctg
ctcaagagcgacaagcgcctgctgccgctggacgcggagctggagcaattgttctccacc
tggttcgatgtggcgttcctcgaactgaggcgcctgtcgtgggattcgcccgcctcactg
atcgaaaagctcatcaagtacgaggcggtgcacgacatccgcagctgggcggacctgaag
aaccgactggacagcgaccgccgctgctacgggttctttcacccccgcctgcccaatgag
ccgctgatcttcgtggaggtggcgctggtcaacgagatttcgtccagcatcaccccgctg
ctggacgaggccgccgaggccgccgacatccagcgtgccaccacggcgatcttctactcg
atcagcagcacgcagacggggctgcgcggcgtgagcttcggcgattcgctcatcaagcac
gtggccgagacgctcacgcaggaattcccgcgcctgcgcaccttcgccacgctctcgccg
atcccgggctttcgttcctggctgtccaagaactgcgccgcgcagctggagcagctcgac
gagaagcgcctggccgaactgggccgcgccgtgggcttcgagccgccgcaggccgcgcat
gtgctggccgcggccgacaaggcgctggagctgccgcccaagtcacccgtgcgccagctg
ctcatgcagtgcgcggcgcgctacctgggacgcgagctgcacgacggcaagccggtggac
ccggtggcgcgctttcacctgggcaatggcgcgcgcgtggagcggttgaactgggcgggt
gacccgtcggccaaggggctcaagcagtccttcgggctgatggtcaactacctgtatgac
ctcaagcgcatcgacaagcaccacggcctgcttgcgcaggggcgcgtgcccgtgtcgggc
gatatcgacagcctgtgccgtgactga

DBGET integrated database retrieval system