KEGG   Acidovorax ebreus: Dtpsy_1078Help
Entry
Dtpsy_1078        CDS       T00853                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
dia  Acidovorax ebreus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1125663..1127186)
Genome map
AA seq 507 aa AA seqDB search
MASAKSPSEIARETLKLLATRRLPPTPDHYQALYDEVAGTTSAPAFPSAQLRQISRVIPG
QTPAQKRLLGLLETAITQQDWGVLQNVLVGYANLGLSPVAAPEPASTRIDHLPLTLAQNL
ARLVDNTLPALGEDDARVHELAAQLSTFLREPDPPVSTAELMLGNFSYRLSFAAEDQAAI
RLSLLSLLRLVFENIAALSMDDEWLHGQAEALLAASTPPLTLRRLDDVQRRLKDVIFKQT
EAKERTVHAQMQMRELLATFIERLAQMDESSSAYNTKMEDCAERISQATQLQDIMPLLEE
VMAATRAMALSSRVTRGELQELRERTEAKHAEIDHLRQELDRASAQARHDPLTGSLNRKG
FAEAMEREIARARRQDAPLCVALLDVDNFKSINDRLGHTAGDAALVHLAQVTREVMRPQD
QLARYGGEEFVIILPDTELAEGVKAMERLQRELTTRYFLKDQERVLITFSAGVAQVEGEQ
GSADAIRRADQGMYLAKRTGKNRVVAA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgccaaatccccttctgaaattgcccgcgagacgctcaagctactcgccacg
cgccggcttcctcccacgcccgaccactaccaggccctctatgacgaagtggccggcacc
accagcgcgccggcgtttcccagcgcccagctgcggcagatctcgcgggtgatccccggc
cagaccccggcgcagaagcggttgctgggcctgttggaaaccgccatcacccagcaggac
tggggcgttttgcaaaacgtgttggtgggatacgccaacctgggactctcgcccgtggct
gcgcccgagcccgcgagcacccggattgaccacctgccgctgacactggcgcagaatctg
gcgcggctggtggacaacaccctgccggcgctgggcgaggacgatgcccgcgtgcatgag
ctggctgcgcaattgagcaccttcctgcgcgagcccgacccacccgtctccaccgccgag
ctgatgctcggcaacttcagctaccgcctgtctttcgcggcggaagaccaggccgccatc
cggctgagcttgctcagcctgctgcgcctggtgttcgagaacattgccgccctgagcatg
gacgacgagtggctgcacggccaggccgaggcgctgcttgcggcctccaccccgccgctc
acgctgcgccggctggacgacgtgcagcgacgcctcaaggacgtcatcttcaagcagact
gaggccaaggaacgcaccgttcacgcccagatgcagatgcgcgaactgctggccacattc
atcgagcgcctggcgcagatggatgaatccagcagcgcctacaacaccaagatggaggat
tgcgccgagcgcatcagccaggccacgcaactgcaggacatcatgccgctgctggaagaa
gtcatggccgccacgcgcgccatggcgctgagcagccgggtgacgcgcggcgaactgcag
gaactacgcgagcgcaccgaggccaagcacgccgaaatcgaccacctgcgccaggagctg
gaccgcgcgagcgcccaggcgcgccacgacccgttgacgggctcgctcaaccgcaagggc
tttgccgaggccatggagcgcgagatcgcgcgtgcgcgccgccaggacgcgccgctgtgc
gtggcgctgctggacgtggacaacttcaagtccatcaatgaccgcctgggccacaccgcc
ggcgacgcggcactggtgcatctggcgcaggtcacccgcgaggtgatgcgaccgcaggac
cagttggcgcgctatggcggcgaggaattcgtcatcatcctgcccgacaccgaactggcg
gaaggcgtgaaggccatggagcgcctgcaacgcgagctgaccacgcgctacttcctcaaa
gaccaggagcgggtgctcatcaccttcagcgccggtgtggcccaagtggagggcgaacaa
ggcagcgccgacgcaatccgccgcgccgaccagggcatgtacctggccaagcgcaccggc
aaaaaccgcgtggttgctgcctga

DBGET integrated database retrieval system