KEGG   Acidovorax ebreus: Dtpsy_1079Help
Entry
Dtpsy_1079        CDS       T00853                                 

Definition
alcohol dehydrogenase zinc-binding domain-containing protein
Orthology
K00344  
NADPH2:quinone reductase [EC:1.6.5.5]
Organism
dia  Acidovorax ebreus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1127280..1128254)
Genome map
AA seq 324 aa AA seqDB search
MHAWLCTNPTGVEALAWTELPDPAPKAGEVLVEIRAASLNFPDLLIVQNKYQIKPPLPFV
PGSEFAGVVQAVGDGVTHLQVGQNVACLSGTGGFATHTIAPAARCIPLPDGFGHVDAAAF
IMTYATSYHALLDRGQLQAGETVLVLGAAGGVGTAAIQIAKAKGARVIAAASTDEKCDVC
LKLGADAVINYSVEDLRDAAKSLTDGRGPDVIYDPVGGALAEPAFRSIAWRGRYLVVGFA
SGPIPSLPLNLPLLKGASVVGVFWGEFAKREPQANASMMGTLLQWYAQGKIRPAIDRTMP
MSQLPAAFAHMGARAVIGKLVLVN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcctggctctgcaccaaccccaccggcgtcgaggccctggcctggacagaactg
cccgacccggctcccaaggcgggcgaggtcctcgtcgagatccgcgcggcaagcctgaat
tttcccgacctgctgatagtgcagaacaagtaccagatcaaaccacccctgcctttcgtg
cccggctcggagttcgcgggcgtcgtgcaggccgtgggcgacggcgtcacccatctgcag
gtgggtcaaaacgtggcctgcctcagcggcacgggtggcttcgccacgcacaccatcgcc
ccggccgcacgctgtatacccctgccggacggctttggccatgtggatgcggcggcattc
atcatgacctatgcaacctcctaccacgccctgctggaccggggccagctccaggcaggc
gaaaccgtgctggtgctgggcgcggccggcggcgtgggcactgccgcgattcagatcgcc
aaggccaagggagcgcgcgtgatcgcagccgcctccacggacgaaaaatgcgacgtgtgc
ctgaagctgggcgccgatgccgtgatcaattacagcgtggaggacctgcgcgacgccgcc
aagtcactgaccgacgggcggggaccggacgtcatctacgacccggtgggcggcgcactg
gcagagcccgcatttcgctccatcgcctggcgaggccgctatctggtggtcggcttcgca
tcgggccccatcccttcattgccgttgaatctgccactgctcaagggtgcttctgtcgtc
ggcgtgttctggggcgaattcgccaagcgcgagccccaggccaatgcttcgatgatgggc
accctgctccagtggtatgcgcagggcaagatcaggcccgccatcgaccgaaccatgccc
atgtcacagctacccgccgcgtttgcccacatgggcgcacgtgcggtgatcggcaaactg
gttctggtcaactga

DBGET integrated database retrieval system