KEGG   Acidovorax ebreus: Dtpsy_1229Help
Entry
Dtpsy_1229        CDS       T00853                                 

Definition
1-deoxy-d-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dia  Acidovorax ebreus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:dia00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1290491..1291663
Genome map
AA seq 390 aa AA seqDB search
MKQRLTVLGSTGSIGTSTLDVVARHPDRYEVFALSAATQVDLMLAQCAQFRPRYAVMASS
AHARQLADKLQQSGLPTEVLQTPDALQAIASHEEVDAVMAAIVGAAGLAPCLAAARAGKR
LLLANKEALVVGGEVFMAAVREGGATLLPIDSEHSAIFQSLPEDPATWPRRVDHVLLTAS
GGPFRTRDPATLRDVTPAQACAHPNFSMGRKISIDSATMMNKALEVIEARWLFNLAPEQI
KVVIHPQQIIHSMVQFVDASIIAQLGTPDMRVPIACGLAWPERVESGAAPLDFTQLAALT
FEEADATRFPGLHLSWQALRAAPGTTAVLNAANEVAVAAFLEQRIRFDQIHALNLATLEA
VEPSNPDSLDALLALDARTRARSAELMARL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacgtctcacggtgctgggttctacgggatccatcggcaccagcaccctcgac
gtggtggcacgccaccccgatcgctacgaagtctttgcgctgagcgcggccacgcaggtg
gacctgatgctggcgcagtgcgcgcagttccgtccgcgctatgcggtgatggccagcagt
gcgcatgcgcgccagctggcagacaaactgcagcagagcggcttgcccaccgaggtgctg
caaacacccgatgcgctgcaagccattgcctcgcacgaagaggtggacgcggtcatggcg
gccatcgtgggcgcggcgggcctggcgccgtgcctggcggccgcgcgtgcgggcaagcgc
ctgctgctggccaacaaggaggcgctggtcgtcgggggcgaggtgttcatggccgcggtg
cgcgaaggcggcgccacgctgctgcccatcgacagcgagcattccgccatcttccagagc
ctgcccgaagaccccgccacctggccgcggcgcgtggaccacgtgctgctcaccgcgtcg
ggcgggccgtttcgcacgcgcgacccggccacgctgcgcgacgtgacgccggcgcaggcc
tgcgcgcatcccaacttctcgatgggccgcaagatttccatcgactcggccacgatgatg
aacaaggcgctggaggtgatcgaggcgcgctggctgttcaacctggcgcctgagcagatc
aaggtggtcatccacccgcagcagatcatccactccatggtgcagtttgtggacgcgtcc
atcattgcccagttgggcacgcccgatatgcgcgtgcccatcgcctgtggcctggcctgg
cccgagcgggtggaaagcggcgcggcgcccctggatttcacgcaactggcagcgctgacc
ttcgaagaagcggatgccacgcgctttcccgggctgcacctgtcctggcaggcgttgcgc
gcggcgcccggcaccacggccgtgctcaatgccgccaacgaggtggcagtggcggctttc
ctggagcagcgcatacgtttcgaccagatccatgcgctcaaccttgcaactttggaagcc
gtcgaaccgtccaacccggactcgctggacgcactgctggcgctggatgcgcgcacgcgt
gcgcggtccgcggagttgatggcgcgcttgtga

DBGET integrated database retrieval system