KEGG   Acidovorax ebreus: Dtpsy_1603Help
Entry
Dtpsy_1603        CDS       T00853                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dia  Acidovorax ebreus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Dtpsy_1603
Enzymes [BR:dia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dtpsy_1603
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Dtpsy_1603
Lipid biosynthesis proteins [BR:dia01004]
 Fatty acid synthase
  Component type
   Dtpsy_1603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1696607..1697254)
Genome map
AA seq 215 aa AA seqDB search
MVRRDFIVAGALALWGAAPALAQSGGKKPTRAPVILVVGDSLSAEYGLPRGTGWVALLDK
RLAQEKIPATVVNASVSGDTTAGGRARLAALLQQHRPTHVVIELGGNDALRGLPLASTQG
NLAWMTEQAQAAGARVLLVGVQVPPNYGANYTRQFAEVFENVAQERKAALVPFLLKGVAD
GPDPTALFQPDRIHPTAQAHPRMLDNVWPALRALL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggttcggcgtgactttatcgtggcgggcgccctggccctgtggggcgcggcgcccgcc
cttgcgcagtccggtggcaagaagcccacccgcgcgcccgtgatcctggtggtgggcgac
tcgctcagcgccgaatacggcctgccgcgcggcaccggctgggtggcgctgctggacaag
cggctagcgcaggagaagatccccgccacggtggtcaacgccagcgtgagcggcgacacc
accgccggcggccgcgcgcggctggccgcactgctccagcagcaccggcctacgcatgtg
gtgatcgaactcggcggcaacgacgccttgcgcggcctgccgctggccagcacccagggc
aatctggcgtggatgaccgaacaggcccaggccgcgggcgcgcgcgtgctgctggtgggt
gtgcaggtgccgcctaactacggcgccaactacacccggcagttcgccgaggtcttcgaa
aacgtggcccaggagcgcaaggcggcgctcgtgcccttcctgctcaagggcgtggccgat
gggcccgatcccacggcgctgttccagcccgaccgcatccaccccacggcccaggcgcac
ccgcgcatgctggacaacgtgtggcccgcgctgcgcgcgttgctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system