KEGG   Acidovorax ebreus: Dtpsy_1658Help
Entry
Dtpsy_1658        CDS       T00853                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dia  Acidovorax ebreus
Pathway
dia00010  Glycolysis / Gluconeogenesis
dia00020  Citrate cycle (TCA cycle)
dia00620  Pyruvate metabolism
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01120  Microbial metabolism in diverse environments
dia01130  Biosynthesis of antibiotics
dia01200  Carbon metabolism
Module
dia_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtpsy_1658
   00020 Citrate cycle (TCA cycle)
    Dtpsy_1658
   00620 Pyruvate metabolism
    Dtpsy_1658
Enzymes [BR:dia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dtpsy_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H PYNP_C RnfC_N NQRA HlyD_D23 Peptidase_M23 DUF4813
Motif
Other DBs
NCBI-ProteinID: ACM33116
UniProt: B9MIV0
Position
1751433..1753118
Genome map
AA seq 561 aa AA seqDB search
MALVNIQVPDIGDFDEVGVIELLVKVGDTVKAEQSLITVESDKASMEIPSSHAGVVKELK
VQLGDKVKQGSVIAVLEATGEAAASDEKPAPAPAAQAPAAIETQAPAAPAAPAAPAAGGG
AVEVRVPDIGDFKDVAVIELLVQPGDAVKVEQSLFTVESDKASMEIPSPAAGVLKELKVK
IGDKINVGDLVAVLEGAAAAPAAAPAQGSTPAAASAPAAAAPVAAQASAPAPAAATATAP
VPAHQPSTPTPGLPHASPSVRKFARELGVPLAEVKGTGIKGRITQEDVAAFTRQVMSGAL
QTQAQGSKAPAAGGSGVGLDLLPWPKVDFAKFGPVERKELSRIKKISGANLSRNWVMIPH
VTNNDEADITELEAFRVSTNKENEKSGVKVTMLAFVIKAVVAALKKFPEFNASLDGDALV
YKQYFHIGFAADTPNGLVVPVLKDADKKGILQISAEMAELAKKARDGKLGAADMQGGSMS
ISSLGGIGGTHFTPIINAPEVAILGLSKSQMKPVWDGQQFVPRLTLPLSLSYDHRVIDGA
SAARFNAYLGQVLADYRRILL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcattggtaaacatccaggttcccgacatcggcgacttcgacgaagtcggcgtgatc
gagctgctggtcaaggtgggcgacacggtgaaggcggagcagtcgctgatcaccgtggag
tccgacaaggcctcgatggaaatcccgtcgagccacgcgggtgtggtcaaggaactcaag
gtccagctgggcgacaaggtcaagcagggcagcgtgatcgccgtgctggaggccacgggc
gaagccgctgcttctgatgaaaaaccggctccagcgcccgccgcgcaagcgccggcagct
atcgaaacgcaagcgcctgccgcgcctgctgcacccgccgcccctgctgcgggtggtggc
gcggttgaggtgcgtgtgcccgacatcggtgacttcaaggacgtcgccgtgatcgagttg
ctggtccagcccggcgatgcggtcaaggtggagcagtcgctgttcaccgtggagtccgac
aaggcctcgatggagatcccttcgcccgccgccggcgttctcaaggagctcaaggtcaag
atcggcgacaagatcaatgtgggcgatctcgtggcggtgcttgaaggtgccgccgctgca
ccggctgccgccccggcgcagggttctacaccagcggccgcttccgctccggccgctgcc
gcgcccgtggcggctcaggcctccgcgcccgcaccagctgcggcaacggcaacggcgccc
gtgccggcccaccagccctcgacgcccacgccgggcctgccgcacgccagcccctcggtg
cgcaagttcgcccgcgaactgggtgtgccgctggcggaggtcaagggcacgggcatcaag
ggccgcatcacgcaggaggatgtggcggccttcacgcgccaggtgatgagcggtgcgctg
cagacccaggcacagggcagcaaggcgcccgctgcgggtggctccggggtgggcctggac
ctgctgccgtggcccaaggtggacttcgccaagttcggccccgtcgagcgcaaggagctg
tcgcgcatcaagaagatcagcggcgccaacctgtcgcgcaactgggtgatgattccccac
gtcaccaacaacgacgaggccgacatcaccgaactggaagccttccgcgtctccaccaac
aaggagaacgagaagagcggcgtcaaggtcaccatgctggccttcgtcatcaaggccgtg
gtcgcggcgctgaagaagttccccgagttcaacgccagcctggacggcgacgcgctggtc
tacaagcagtacttccacatcggctttgcggccgacacgcccaacggcctggtggtgcct
gtgctgaaagatgccgacaagaagggcatcctgcaaatcagcgccgagatggccgagctg
gccaagaaggcccgcgacggcaagctgggtgcggccgacatgcagggcggcagcatgtcg
atcagctcgctgggcggcattggcggcacgcatttcacccccatcatcaatgcgcccgag
gtggccatcctcggcctgtccaagagccagatgaagcccgtgtgggacggccagcagttc
gtgccgcgcctcacgctgccgctgagcctgtcgtacgaccaccgcgtgatcgacggcgcc
tctgccgcgcgcttcaacgcctacctgggtcaggtgttggcggactaccgccgcatcctg
ctgtaa

DBGET integrated database retrieval system