KEGG   Acidovorax ebreus: Dtpsy_1693Help
Entry
Dtpsy_1693        CDS       T00853                                 

Definition
alcohol dehydrogenase groes domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dia  Acidovorax ebreus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dtpsy_1693
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtpsy_1693
  Lipid metabolism
   00071 Fatty acid degradation
    Dtpsy_1693
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dtpsy_1693
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dtpsy_1693
   00626 Naphthalene degradation
    Dtpsy_1693
Enzymes [BR:dia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dtpsy_1693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1795808..1796839)
Genome map
AA seq 343 aa AA seqDB search
MPAKTMKAAVVREFGKPLTIEEVPVPAPTADQILVKIEASGVCHTDLHAAEGDWPVKPNP
PFIPGHEGVGFVAAVGANVKHVKEGDRVGVPWLHSACGCCTHCLGGWETLCESQSNTGYS
VNGGFADYALADPNYVGHLPKDVGFVDIAPVLCAGVTVYKGLKVTDTKPGDWVAISGIGG
LGHMAVQYARAMGLNVAAVDVDDNKLALARQLGASVTVNARDTDPAAFLQKEIGGAHGAL
VTAVSPKAFEQALGMVRRGGTVSLNGLPPGNFPLPIFDMVLRGVTVRGSIVGTRLDLQES
LDFAARGQVKATVRTEKLENINDVFARMHKGQIQGRVVLDMAA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgccagccaagacaatgaaagccgccgtggtccgtgagttcggcaagccgctgacgatc
gaagaggtgcccgtgcccgcccccaccgccgaccagatcctggtgaagatcgaggcctcg
ggcgtgtgccacaccgacctgcacgccgccgagggcgactggcccgtcaagcccaatccg
cccttcatcccggggcatgagggcgtgggcttcgtcgctgccgtgggggccaacgtcaag
catgtgaaggaaggcgaccgcgtaggcgtgccctggctgcactcggcctgcggctgttgc
acgcactgcctgggtggttgggagacgctgtgcgagtcgcagagcaacacggggtattcg
gtcaacggcggttttgccgactacgcgctggccgaccccaactacgtgggccacctgccg
aaagacgtgggcttcgtggacatcgcccccgtgctgtgcgccggcgtgaccgtgtacaaa
ggcctgaaggtgaccgacaccaagcccggcgactgggtggcgatttccggcattggcggc
ctgggccacatggccgtgcagtacgcccgcgccatggggctgaacgtggctgcggtggac
gtggacgacaacaagctcgcgctggcccgccagctgggcgccagcgtgacggtgaacgcg
cgcgacaccgacccggccgccttcctgcaaaaggagatcggcggtgcgcacggtgcgctg
gtcacggccgtgtcgcccaaggccttcgagcaggcgctgggcatggtgcggcgcggcggc
acggtgtcgctcaacgggttgccgccgggcaactttccgctgcccatcttcgacatggtg
ctgcgcggcgtgaccgtgcgcggctccatcgtcggcacgcggctggacctgcaggagtcg
ctggacttcgccgcgcgcggccaggtgaaggccacggtgcgcaccgagaagctggagaac
atcaacgacgtgttcgcgcgcatgcacaagggccagatccagggccgcgtggtgctggac
atggcggcctga

DBGET integrated database retrieval system