KEGG   Acidovorax ebreus: Dtpsy_1726Help
Entry
Dtpsy_1726        CDS       T00853                                 

Definition
DNA polymerase iii subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
dia  Acidovorax ebreus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dtpsy_1726
   00240 Pyrimidine metabolism
    Dtpsy_1726
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dtpsy_1726
   03430 Mismatch repair
    Dtpsy_1726
   03440 Homologous recombination
    Dtpsy_1726
Enzymes [BR:dia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Dtpsy_1726
DNA replication proteins [BR:dia03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Dtpsy_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1833161..1833601
Genome map
AA seq 146 aa AA seqDB search
MTQVAFHFNAPDKLAYVCRLVRKATRQEARVTVTGDADTLLRLDRQLWALAPSDFVGHCL
GDADEEILRASPTVLVQDPRTSPNRDVLVNLGNVLPEGFAQYARVVEVVSQADEDDRKRA
RERWRGYAALGYDIVRHDLVLKESAG
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggtggcattccacttcaatgcacccgacaaactggcgtatgtctgtcgcctg
gtgcgaaaagccacccggcaggaggcgcgggtgacggtcacgggtgatgcagacaccttg
ctgcggctcgatcgccagctctgggcgttggcgccttcggatttcgtcggccattgcctg
ggagacgccgacgaggaaattctgcgtgcctctcccaccgtgttggtgcaagaccctcgt
accagtccgaatcgggacgtgttggtcaacctgggaaatgtcttgcccgagggatttgcg
cagtacgctcgggtcgtggaggtggtcagccaggcggatgaggatgatcggaagcgcgcg
cgggagcgctggcgcggctatgccgcgctggggtatgacatcgttcgccacgatctggta
ctcaaggaaagcgcgggatga

DBGET integrated database retrieval system