KEGG   Acidovorax ebreus: Dtpsy_1726Help
Entry
Dtpsy_1726        CDS       T00853                                 

Definition
DNA polymerase iii subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
dia  Acidovorax ebreus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dia00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dia00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:dia03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:dia03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dia03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1833161..1833601
Genome map
AA seq 146 aa AA seqDB search
MTQVAFHFNAPDKLAYVCRLVRKATRQEARVTVTGDADTLLRLDRQLWALAPSDFVGHCL
GDADEEILRASPTVLVQDPRTSPNRDVLVNLGNVLPEGFAQYARVVEVVSQADEDDRKRA
RERWRGYAALGYDIVRHDLVLKESAG
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggtggcattccacttcaatgcacccgacaaactggcgtatgtctgtcgcctg
gtgcgaaaagccacccggcaggaggcgcgggtgacggtcacgggtgatgcagacaccttg
ctgcggctcgatcgccagctctgggcgttggcgccttcggatttcgtcggccattgcctg
ggagacgccgacgaggaaattctgcgtgcctctcccaccgtgttggtgcaagaccctcgt
accagtccgaatcgggacgtgttggtcaacctgggaaatgtcttgcccgagggatttgcg
cagtacgctcgggtcgtggaggtggtcagccaggcggatgaggatgatcggaagcgcgcg
cgggagcgctggcgcggctatgccgcgctggggtatgacatcgttcgccacgatctggta
ctcaaggaaagcgcgggatga

DBGET integrated database retrieval system