KEGG   Acidovorax ebreus: Dtpsy_1800Help
Entry
Dtpsy_1800        CDS       T00853                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dia  Acidovorax ebreus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dtpsy_1800
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dtpsy_1800
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dtpsy_1800
Enzymes [BR:dia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dtpsy_1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1916001..1917209)
Genome map
AA seq 402 aa AA seqDB search
MTASTDFAPMPDAAGFFGPYGGQLVPPHLKAAMDDIAAAYAEITQRKDFQDELAQLFADY
VGRPSPIFHAKRLSGLLGGAQIHLKREDLNHTGAHKINHCLGEALLAKFMGKKKVIAETG
AGQHGVALATACALVGIPCEIHMGQVDIEKEHPNVTKMRILGCKLVAVTRGAATLKEAVD
SAFEEYLTNPTDYLYAIGSVVGPHPFPMMVRDFQSIIGREAREQFQARHGRLPDYVTACV
GGGSNAMGMFTAFLGDTDVKLVGVEPSGEGTDKPGRHAATLSMGQPGEIHGMKCYVLEDA
PGVPAAVHSIASGLDYPGVGPQHSYLKDIGRVQYEAVTDKECLDAFMQLSRVEGIIPALE
SAHAVAWAIRVAPTLPQDQHILVNLSGRGDKDADYVAKVLGL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacagcctccaccgacttcgcccccatgcccgatgccgccggcttctttggcccctac
ggcgggcagcttgtgccgccgcacctgaaagccgccatggacgacatcgccgcggcctat
gccgagatcacgcagcgcaaggactttcaggacgagctggcacagctgtttgccgattac
gtgggccggcccagcccgatctttcatgccaagcggctttcgggcctgctgggcggcgcg
cagatccacctcaagcgcgaggacctgaaccacaccggcgcgcacaagatcaaccactgc
ctgggcgaggcgctgctggccaagttcatgggcaagaaaaaggtaatcgccgagacgggc
gccggccagcacggtgtggcgctggccacggcctgtgcgctggtgggcatcccgtgcgag
atccacatgggccaggtggacatcgagaaggagcaccccaacgtcaccaagatgcgcatc
ctgggctgcaagctggtggcggtgacgcgcggcgcggccacgctgaaggaggcggtggac
agcgccttcgaagagtacctgaccaaccccaccgactacctctacgccatcggctcggtg
gtgggcccgcacccgttcccgatgatggtgcgcgacttccagagcatcatcggccgcgag
gcgcgcgagcagttccaggccaggcacggccgcctgcccgactacgtgaccgcctgcgtg
ggcggcggcagcaatgccatgggcatgttcaccgccttcctgggcgataccgatgtgaag
ctggtgggcgtggaaccctcgggcgaaggcaccgacaagcccggccggcacgcggccacg
ctgagcatgggccagcccggtgagatccacggcatgaagtgctatgtgctggaggatgcg
ccgggcgtgcctgccgccgtgcacagcattgcctcgggcctggactaccccggcgtgggc
ccgcagcacagctatctgaaggacattggccgcgtgcagtacgaagccgtgaccgacaag
gaatgtctggacgcgttcatgcagctgtcgcgcgtggaaggaatcatccccgcgctggag
agcgcccatgccgtggcctgggccatccgcgtggcgcccacgctgccccaggaccagcac
atcctggtcaacctgtcgggccgcggcgacaaggatgcggattacgtcgccaaggtgctg
gggctttga

DBGET integrated database retrieval system