KEGG   Acidovorax ebreus: Dtpsy_1905Help
Entry
Dtpsy_1905        CDS       T00853                                 

Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dia  Acidovorax ebreus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtpsy_1905
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dtpsy_1905
  Amino acid metabolism
   00310 Lysine degradation
    Dtpsy_1905
Enzymes [BR:dia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dtpsy_1905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2035102..2036367)
Genome map
AA seq 421 aa AA seqDB search
MAIVEVKVPQLSESVAEATLLQWKKKPGEAVAIDEILIEIETDKVVLEVPAPAAGVMAEI
VVADGGTVASDQVIAKIDTEGKAGAAAPAAAAAAPAPAAASAPAAAAPAAAGGSKGDVAM
PAAAKLLADNNLSVGDVTGSGKDGRVTKGDVLAAVAGGVKSTAAVIPTGVPTKALPQVAA
PSSAADLGERPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMDLRKKFQDAF
TKEHGVKLGFMSFFVKAAVHALKKYPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPIL
RNADQMSFADIEKKIAEFGKKAADGKLGIEEMTGGTFSISNGGTFGSMMSTPIINPPQSA
ILGVHATKDRAVVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPSRLLFD
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctgtccgagtccgtggccgaagccaccctg
ctgcagtggaagaagaagcccggcgaggccgtggcaatcgatgaaatcctgatcgaaatc
gagaccgacaaggtggtgctggaagtgcccgcaccggccgccggcgtgatggccgagatc
gtggtcgccgacggcggcaccgtggcctccgaccaggtcatcgccaagatcgacaccgag
ggcaaggccggcgcggccgcgccggcagctgctgccgctgcaccggcgcccgcagcggca
tctgccccggcggccgctgcgcctgccgctgctggcggcagcaagggcgacgtggccatg
ccggccgccgccaagctgctggccgacaacaacctgtcggtcggcgatgtgacgggctcc
ggcaaggacggacgcgtgaccaagggcgatgtgctggccgcagtggcaggcggcgtgaag
tcgacggccgccgtgatccccaccggcgtgcccaccaaggcgctgccccaggtagcagcc
ccgtcgtccgctgctgatctgggcgagcgccccgagcagcgcgtgcccatgagccgcttg
cgtgcccgcgtggccgagcgtctgctgcaatcgcagtccaccaacgccatcctcaccacg
ttcaacgaagtgaacatggcgccggtgatggacctgcgcaagaagttccaggacgcattc
accaaggagcacggcgtgaagctgggcttcatgtccttcttcgtaaaggccgcggtgcat
gccctcaagaagtacccggtgctcaacgcctcggtggacggcaacgacatcgtctaccac
ggctacttcgacatcggtatcgccgtgggctcgccgcgcggcctggtggtgcccatcctg
cgcaacgcagaccagatgagctttgccgacatcgaaaagaagatcgccgaattcggcaag
aaggcggccgacggcaagctgggcatcgaagagatgaccggtggcacgttctccatctcc
aacggcggcaccttcggctcgatgatgtccacccccatcatcaacccgccgcagtcggcc
atcctgggcgtgcacgccaccaaggaccgcgccgtggtcgaaaacggccaggtcgtggtg
cgtccgatgaactacctggccatgtcttatgaccaccgcatcatcgacggccgcgaagcc
gtgctgggcctcgtggctatgaaggacgcgctggaagacccgtcgcgcctgttgttcgac
ctgtaa

DBGET integrated database retrieval system