KEGG   Acidovorax ebreus: Dtpsy_2284Help
Entry
Dtpsy_2284        CDS       T00853                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dia  Acidovorax ebreus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtpsy_2284
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dtpsy_2284
   00650 Butanoate metabolism
    Dtpsy_2284
  Energy metabolism
   00190 Oxidative phosphorylation
    Dtpsy_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2428091..2428456
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRTVVGAHYGVRDWLVQRATAVLMALFTLVLLACVIFSKGPIGYDLWAGIFSS
QWMKVLTLSVIVALAWHAWVGVRNVWMDYIKPAGLRLTLQVFTIVWLVACTGWGIQVLWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaattacggctccaagcgcaccgtcgtgggtgcccactatggcgtgcgcgac
tggctggtgcagcgcgccaccgccgtcttgatggctttgttcaccctggtgctgctggcc
tgcgtcatcttcagcaagggccccatcggctacgacctgtgggccggcatcttctccagc
cagtggatgaaggttctgaccctgtccgtcatcgtggcgctggcctggcacgcctgggta
ggcgtgcgcaacgtgtggatggactacatcaagccggcaggcctgcgtctgacgctgcaa
gtcttcaccatcgtctggctggtggcctgcaccggctggggcatccaggttctgtggcgt
ctctga

DBGET integrated database retrieval system