KEGG   Acidovorax ebreus: Dtpsy_2378Help
Entry
Dtpsy_2378        CDS       T00853                                 

Definition
uroporphyrinogen-iii synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dia  Acidovorax ebreus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dtpsy_2378
Enzymes [BR:dia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dtpsy_2378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2531376..2532194
Genome map
AA seq 272 aa AA seqDB search
MPVQSPRAIVTRPAREATQWAADLQARGIAALALPLIAIGPVTNPALREELQQARACVDR
YCAVMFVSGNAAQYFFESNMPLALSGQALAATKTRVWAPGPGTVAALVQAGVATERIDAP
GADAAQFDSEALWQVVAPQIGPGDRVLIVRGANAPTAEGGNGREWLARQIAAAGGAVDFV
AAYERGAPCLDAQQLVLAQAAASDGSVWLLSSSEAIANLRAVLPAQHWGMARALTTHPRI
AQAARAAGFGSVHECRPAFDEVAASIESLYEQ
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgtgcagtcgccccgggccatcgtcacgcgccccgcgcgcgaggccacgcagtgg
gccgccgatctgcaggcgcgcggcatcgccgcgctggcgctgccactcatcgccatcggc
ccggtgaccaacccggctctgcgcgaggaactgcaacaggcccgcgcatgcgtggaccgc
tactgcgcggtgatgttcgtgagcggcaacgcggcgcagtatttctttgaatcaaatatg
cctctagcgctttctggacaagcgttagcagctaccaaaacgagagtatgggctcccggc
cccggtaccgtggcggcactcgtgcaggccggggttgcgaccgagcgcattgacgctccc
ggcgccgacgccgcgcagtttgactccgaagccctgtggcaggtggtcgcgccgcagatc
ggcccgggcgaccgcgtgctcatcgtgcgtggagccaacgcccccacggccgaaggcggc
aacgggcgcgaatggctggcccggcagattgccgctgcgggtggcgcggtggacttcgtc
gccgcgtacgagcgcggcgcaccctgcctcgacgcccagcaactggtgctggcgcaagca
gccgccagcgacggctcggtctggctgctgagcagttccgaggccatcgccaacctgcgt
gctgtgttgcccgcgcaacactggggcatggcccgcgccctgaccacccacccgcgtatc
gcgcaggccgcacgtgcggccggctttggcagcgtgcacgaatgccgtccggcgttcgat
gaagtggcagcctcgatagaatcgctttatgagcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system