KEGG   Acidovorax ebreus: Dtpsy_2383Help
Entry
Dtpsy_2383        CDS       T00853                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dia  Acidovorax ebreus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dia00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dia00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dia00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dia00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2538387..2539274
Genome map
AA seq 295 aa AA seqDB search
MNAPTRVRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYEAGIRDMVFVT
GRSKRAIEDHFDTAYELENELENAGKREMLALVRSIAPDDMNCLFVRQPRSLGLGHAVLC
AEPLVGNEPFAVILADDLMTGEPGGPGVMAQMTAAFAKQGRSLLAVQEVPLEHTKRYGIV
KGESAGGALIRVDEIVEKPAPEKAPSRMGVAGRYVLTPRIFEEIRNQPQGVGGEIQLTDA
IARLMQHETVYAYQYAGKRYDCGSKEGFLEATVELALQHPQVGPQFREYLQSLAL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcacccacccgtgtccgcaaggccgtctttcccgtcgcagggctcggcacccgc
ttcctgcccgccaccaaggcatcgcccaaggagatgctgccggtggtggacaagcccctg
atccagtacgcggtcgaggaggcctacgaggccggcatccgcgacatggtgttcgtcacc
ggccgcagcaagcgcgcgatcgaagaccatttcgataccgcgtacgaactggagaacgag
ctggagaacgccggcaagcgcgagatgctcgcgctggtgcgcagcatcgcgcccgacgac
atgaactgcctgtttgtgcgccagccacgctcgctgggcctgggccatgccgtgctgtgc
gccgagcccctggtgggcaacgagccctttgccgtcatcctggccgacgacctgatgacc
ggcgagcccggcggccccggcgtgatggcgcagatgacggccgctttcgccaagcagggg
cgctcgctgctggccgtgcaggaagtcccgctggagcacaccaagcgctacggcatcgtc
aagggcgagagcgctggcggcgcgctgatccgcgtcgacgagatcgtggaaaagcccgcg
cccgaaaaggcaccgtcacgcatgggcgtggccggccgctatgtgctcacgccgcgcatc
ttcgaagagatccgcaaccagccgcagggcgtgggaggcgagatccaactcaccgatgcg
atcgcgcgcctgatgcagcacgagacggtgtatgcctaccagtacgccggcaaacggtac
gactgcggcagcaaggaaggctttttggaagccacggtcgaactggcactgcagcacccc
caggtgggcccacagttccgcgaatacctccaatccctggcgctgtaa

DBGET integrated database retrieval system