KEGG   Acidovorax ebreus: Dtpsy_2383Help
Entry
Dtpsy_2383        CDS       T00853                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dia  Acidovorax ebreus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dtpsy_2383
   00052 Galactose metabolism
    Dtpsy_2383
   00500 Starch and sucrose metabolism
    Dtpsy_2383
   00520 Amino sugar and nucleotide sugar metabolism
    Dtpsy_2383
Enzymes [BR:dia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dtpsy_2383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2538387..2539274
Genome map
AA seq 295 aa AA seqDB search
MNAPTRVRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYEAGIRDMVFVT
GRSKRAIEDHFDTAYELENELENAGKREMLALVRSIAPDDMNCLFVRQPRSLGLGHAVLC
AEPLVGNEPFAVILADDLMTGEPGGPGVMAQMTAAFAKQGRSLLAVQEVPLEHTKRYGIV
KGESAGGALIRVDEIVEKPAPEKAPSRMGVAGRYVLTPRIFEEIRNQPQGVGGEIQLTDA
IARLMQHETVYAYQYAGKRYDCGSKEGFLEATVELALQHPQVGPQFREYLQSLAL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcacccacccgtgtccgcaaggccgtctttcccgtcgcagggctcggcacccgc
ttcctgcccgccaccaaggcatcgcccaaggagatgctgccggtggtggacaagcccctg
atccagtacgcggtcgaggaggcctacgaggccggcatccgcgacatggtgttcgtcacc
ggccgcagcaagcgcgcgatcgaagaccatttcgataccgcgtacgaactggagaacgag
ctggagaacgccggcaagcgcgagatgctcgcgctggtgcgcagcatcgcgcccgacgac
atgaactgcctgtttgtgcgccagccacgctcgctgggcctgggccatgccgtgctgtgc
gccgagcccctggtgggcaacgagccctttgccgtcatcctggccgacgacctgatgacc
ggcgagcccggcggccccggcgtgatggcgcagatgacggccgctttcgccaagcagggg
cgctcgctgctggccgtgcaggaagtcccgctggagcacaccaagcgctacggcatcgtc
aagggcgagagcgctggcggcgcgctgatccgcgtcgacgagatcgtggaaaagcccgcg
cccgaaaaggcaccgtcacgcatgggcgtggccggccgctatgtgctcacgccgcgcatc
ttcgaagagatccgcaaccagccgcagggcgtgggaggcgagatccaactcaccgatgcg
atcgcgcgcctgatgcagcacgagacggtgtatgcctaccagtacgccggcaaacggtac
gactgcggcagcaaggaaggctttttggaagccacggtcgaactggcactgcagcacccc
caggtgggcccacagttccgcgaatacctccaatccctggcgctgtaa

DBGET integrated database retrieval system